MPC1 antibody | knockout validation | Sigma-Aldrich HPA145119
DOI
//dx.doi.org/10.13070/ko.en.6.1850
Date
2016-11-23

This is a knockout-validated antibody summary, based on the publication "MPC1-like Is a Placental Mammal-specific Mitochondrial Pyruvate Carrier Subunit Expressed in Postmeiotic Male Germ Cells", as cited below [1]. Labome curates formal publications to compile a list of antibodies with unambiguous specificity within Validated Antibody Database (VAD).

MPC1 antibody | knockout validation | Sigma-Aldrich HPA145119 figure 1
Figure 1. Western blot of lysates of E13.5 embryos and MEFs from wild-type (+/+) mice and those deleted (gt/gt) for MPC1 (and MPC2). Courtesy of the authors.
Antibody information

Rabbit polyclonal

Company: Sigma-Aldrich

Antibody: MPC1

Catalog number: HPA045119

Summary: Rabbit polyclonal antibody raised against the following recombinant polypeptide sequence: MAGALVRKAADYVRSKDFRDYLMSTHFWGPVANWGLPIAAINDMKKSPEIISGR. Affinity purified antibody. Supplier recommended for WB, IF and IHC. Reacts with human MPC1.

Validation Method

Western blot

Sample

Lysates of MCP1 knockout mouse embryonic fibroblasts plus/minus transduction with MCP1-FLAG.

Primary incubation

Anti-MCP1 antibody.

Secondary incubation

HRP-conjugated anti-rabbit IgG (Dako).

Disclaimer

If the antibody described in this summary is a polyclonal antibody, since polyclonal antibodies are of limited quantity, please inquire the supplier whether any current polyclonal antibody with the same catalog number is exactly the same as the one described in this summary. Sometimes, different bleeds or different animals are used, usually with a different lot number. In such cases, the result in this summary may not apply to the new antibody with the same catalog number.

References
  1. Vanderperre B, Cermakova K, Escoffier J, Kaba M, Bender T, Nef S, et al. MPC1-like: a Placental Mammal-Specific Mitochondrial Pyruvate Carrier Subunit Expressed in Post-Meiotic Male Germ Cells. J Biol Chem. 2016;: pubmed