This is a knockout-validated antibody summary, based on the publication "MPC1-like Is a Placental Mammal-specific Mitochondrial Pyruvate Carrier Subunit Expressed in Postmeiotic Male Germ Cells", as cited below [1]. Labome curates formal publications to compile a list of antibodies with unambiguous specificity within Validated Antibody Database (VAD).

Rabbit polyclonal
Company: Sigma-Aldrich
Antibody: MPC1
Catalog number: HPA045119
Summary: Rabbit polyclonal antibody raised against the following recombinant polypeptide sequence: MAGALVRKAADYVRSKDFRDYLMSTHFWGPVANWGLPIAAINDMKKSPEIISGR. Affinity purified antibody. Supplier recommended for WB, IF and IHC. Reacts with human MPC1.
Western blot
Lysates of MCP1 knockout mouse embryonic fibroblasts plus/minus transduction with MCP1-FLAG.
Anti-MCP1 antibody.
HRP-conjugated anti-rabbit IgG (Dako).
If the antibody described in this summary is a polyclonal antibody, since polyclonal antibodies are of limited quantity, please inquire the supplier whether any current polyclonal antibody with the same catalog number is exactly the same as the one described in this summary. Sometimes, different bleeds or different animals are used, usually with a different lot number. In such cases, the result in this summary may not apply to the new antibody with the same catalog number.
- Vanderperre B, Cermakova K, Escoffier J, Kaba M, Bender T, Nef S, et al. MPC1-like: a Placental Mammal-Specific Mitochondrial Pyruvate Carrier Subunit Expressed in Post-Meiotic Male Germ Cells. J Biol Chem. 2016;: pubmed
- If you are aware of any publication with knockout studies validating a monoclonal or recombinant antibody, either purchased from a supplier or developed by the author(s), please notify us through feedback.
- gene
