product information |
| name: | | Monoclonal Anti-HFE antibody produced in mouse |
| cat_no: | | WH0003077M1 |
| gene id: | | human HFE(3077) |
| brand: | | SIGMA |
| prod_type: | | Chemical |
| name_suffix: | | clone 1G12, purified immunoglobulin, buffered aqueous solution |
| storage temp.: | | -20C |
| storage: | | -20C |
| physical form: | | Solution in phosphate buffered saline, pH 7.2 |
| form: | | buffered aqueous solution |
| antibody form: | | purified immunoglobulin |
| clone: | | 1G12, monoclonal |
| application(s): | | indirect ELISA: suitable; immunoblotting: suitable; indirect immunofluorescence: suitable |
| species reactivity: | | human |
| immunogen: | | HFE (NP_000401, a.a. 115-206) partial recombinant protein with GST tag. MW of the GST tag alone is 26 kDa. |
| wgk: | | NWG |
| shipped in: | | dry ice |
| syns: | | Anti-HFE1; Anti-HH; Anti-HLAH; Anti-MGC103790; Anti-dJ221C16.10.1; Anti-hemochromatosis |
| immunogen sequence: | | SHTLQVILGCEMQEDNSTEGYWKYGYDGQDHLEFCPDTLDWRAAEPRAW
PTKLEWERHKIRARQNRAYLERDCPAQLQQLLELGRGVLDQQ*
(without GST) |
| isotype: | | IgG1kappa |
| more information or order: | | Sigma-Aldrich product webpage |
