product information |
| name: | | Anti-HFE antibody produced in rabbit |
| cat_no: | | AV44285 |
| gene id: | | human HFE(3077) |
| brand: | | SIGMA |
| prod_type: | | Chemical |
| name_suffix: | | affinity isolated antibody, lyophilized powder |
| storage temp.: | | -20C |
| storage: | | -20C |
| physical form: | | Lyophilized from PBS buffer with 2% sucrose |
| form: | | lyophilized powder |
| antibody form: | | affinity isolated antibody |
| clone: | | polyclonal |
| application(s): | | immunohistochemistry: suitable; immunoblotting: suitable |
| species reactivity: | | human |
| immunogen: | | synthetic peptide corresponding to a region of human HFE with an internal ID of P25665 |
| wgk: | | 3 |
| syns: | | Anti-HFE1; Anti-HH; Anti-HLA-H; Anti-Hemochromatosis; Anti-MGC103790; Anti-dJ221C16.10.1 |
| immunogen sequence: | | EPKDVLPNGDGTYQGWITLAVPPGEEQRYTCQVEHPGLDQPLIVIWEPS
P |
| ncbi accession no.: | | NP_620572 |
| availability: | | not available in Canada (due to temporary import restrictions; for questions or status updates, please email us at antibody.canada@sial.com) |
| more information or order: | | Sigma-Aldrich product webpage |
