protein

Recombinant human C-C motif chemokine 20

MBS717218

0.05 mg

195 USD

Recombinant Protein

Recombinant human C-C motif chemokine 20

C-C motif chemokine 20

Recombinant human C-C motif chemokine 20 protein

Homo sapiens chemokine (C-C motif) ligand 20 (CCL20), transcript variant 1, mRNA; C-C motif chemokine 20; C-C motif chemokine 20; CC chemokine LARC; beta chemokine exodus-1; small-inducible cytokine A20; macrophage inflammatory protein 3 alpha; liver and activation-regulated chemokine; small inducible cytokine subfamily A (Cys-Cys), member 20; chemokine (C-C motif) ligand 20; Beta-chemokine exodus-1; CC chemokine LARC; Liver and activation-regulated chemokine; Macrophage inflammatory protein 3 alpha; MIP-3-alpha; Small-inducible cytokine A20

CCL20; CCL20; CKb4; LARC; ST38; MIP3A; MIP-3a; SCYA20; MIP-3-alpha; LARC; MIP3A; SCYA20; MIP-3-alpha

CCL20_HUMAN

E Coli

QPDAINAPVTCCYNFTNRKISVQRLASYRRITSSKCPKE
AVIFKTIVAKEICADPKQKWVQDSMDHLDKQTQTPKT

0.95

Store at -20 degree C. For extended storage, conserve at -20 or -80 degree C.

Tag Information: GST-tagged

Storage Buffer: PBS pH 7.4, 50% glycerol

Chemotactic factor that attracts lymphocytes and, slightly, neutrophils, but not monocytes. Inhibits proliferation of myeloid progenitors in colony formation assays. May be involved in formation and function of the mucosal lymphoid tissues by attracting lymphocytes and dendritic cells towards epithelial cells. C-terminal processed forms have been shown to be equally chemotactically active for leukocytes. Possesses antibacterial activity E.coli ATCC 25922 and S.aureus ATCC 29213.

[1] "Identification through bioinformatics of two new macrophage proinflammatory human chemokines: MIP-3alpha and MIP-3beta.

194239686

NP_004582.1

NM_004591.2

P78556

34 KD

Chemokine Receptors Bind Chemokines Pathway 106359!!Chemokine Signaling Pathway 99051!!Chemokine Signaling Pathway 96864!!Class A/1 (Rhodopsin-like Receptors) Pathway 106357!!Cytokine-cytokine Receptor Interaction Pathway 83051!!Cytokine-cytokine Receptor Interaction Pathway 460!!G Alpha (i) Signalling Events Pathway 119550!!GPCR Downstream Signaling Pathway 119548!!GPCR Ligand Binding Pathway 161020!!Peptide Ligand-binding Receptors Pathway 106358

Function: Chemotactic factor that attracts lymphocytes and, slightly, neutrophils, but not monocytes. Inhibits proliferation of myeloid progenitors in colony formation assays. May be involved in formation and function of the mucosal lymphoid tissues by attracting lymphocytes and dendritic cells towards epithelial cells. C-terminal processed forms have been shown to be equally chemotactically active for leukocytes. Possesses antibacterial activity E.coli ATCC 25922 and S.aureus ATCC 29213. Ref.8. Subunit structure: Binds to and activate CCR6. Subcellular location: Secreted. Tissue specificity: Expressed predominantly in the liver, lymph nodes, appendix, peripheral blood lymphocytes, and fetal lung. Low levels seen in thymus, prostate, testis, small intestine and colon. Induction: By bacterial lipopolysaccharides (LPS), TNF and IFNG/IFN-gamma. Induced by phorbol myristate acetate (PMA) in U937 cell line and bowes melanoma. Repressed by IL10/interleukin-10. Post-translational modification: C-terminal processed forms which lack 1, 3 or 6 amino acids are produced by proteolytic cleavage after secretion from peripheral blood monocytes. Sequence similarities: Belongs to the intercrine beta (chemokine CC) family.

0.05 mg

195 USD