This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
EMD Millipore
other brands :
Oncogene Research Products, Calbiochem, Novagen, Merck, Upstate Biotechnology, Chemicon, LINCO, Novabiochem, Guava
product type :
protein
product name :
β amyloid 11-40, rat and mouse
catalog :
AG546
quantity :
500 µg
product information
Catalog Number :
AG546
Subcategory :
Neuroscience
Product Name :
β amyloid 11-40, rat and mouse
Product Type :
Antibodies
Gene ID :
P05067
Antigen :
β amyloid 11-40
Product Description :
β amyloid 11-40, rat and mouse
Background :
Glu-Val-Arg-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val Comparison of Rat and Human Beta-Amyloid (11-40) sequence EVRHQKLVFFAEDVGSNKGAIIGLMVGGVV - Rat, MW = 3170.74 EVHHQKLVFFAEDVGSNKGAIIGLMVGGVV - Human, MW = 3151.7
Purity :
~95%
Package Size :
500 µg
Uses :
Cell Function Assay
Storage :
Maintain lyophilized material at -20°C for up to 12 months after date of receipt. After reconstitution maintain at -20°C to -70°C for up to 2 weeks in undiluted aliquots. Avoid freeze/thaw cycles to avoid aggregation.
company information
EMD Millipore
290 Concord Road
Billerica, Massachusetts 01821
bioscienceshelp@emdchemical.com
www.emdmillipore.com
888-854-3417
headquarters: United States
EMD Millipore is the Life Science division of Merck KGaA of Darmstadt, Germany

Hundreds of New Antibodies in the areas of:
  • • Cancer
  • • Nuclear Signaling
  • • Apoptosis
  • • Cardiovascular Disease
  • • Developmental Biology
  • • Metabolic Disease
  • • Neurodegenerative Disease
  • • Cell Biology
View all the new antibodies at www.emdmillipore.com.