Labome logo
home > reagent > parathyroid hormone
product
  • Parathyroid hormone (1-34) (rat)
    Tocris Bioscience
    catalog: 6301/1


    Cat.No. 6301 - Parathyroid hormone (1-34) (rat) Ala-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Ala-Ser-Val-Glu-Arg-Met-Gln-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe CAS No. 98614-76-7
    quantity: 1 mg
    price: 322 USD
    to the supplier
  • Parathyroid hormone (1-34) (bovine)
    Tocris Bioscience
    catalog: 6303/1


    Cat.No. 6303 - Parathyroid hormone (1-34) (bovine) AVSEIQFMHNLGKHLSSMERVEWLRKKLQDVHNF CAS No. 12583-68-5
    quantity: 1 mg
    price: 217 USD
    to the supplier
other reagents
  • paraoxon
  • patulin
  • pancreatic polypeptide
  • pemetrexed
  • pentostatin
  • pentylenetetrazole
  • ondansetron
  • peptide yy
  • permethrin
  • okadaic acid
  • phenobarbital
questions and comments

 
Labome.com © 2020 All Rights Reserved
last updated:2020-02-21