PDK1 (3-phosphoinositide-dependent Protein Kinase 1, hPDK1, PDPK1, MGC20087, MGC35290)

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

US Biological

product type :

antibody

product name :

PDK1 (3-phosphoinositide-dependent Protein Kinase 1, hPDK1, PDPK1, MGC20087, MGC35290)

catalog :

131092

quantity :

100 ug

clonality :

monoclonal

host :

mouse

conjugate :

nonconjugated

clone name :

2E2

The same clone is also sold as:

Abnova: H00005170-M05

reactivity :

human

product information

Catalog Number :

131092

Product wo Prefix :

PDK1 (3-phosphoinositide-dependent Protein Kinase 1, hPDK1, PDPK1, MGC20087, MGC35290)

Host :

mouse

Product Type :

Mab

Category :

Antibodies

Size1 :

100 ug

Clone # USB :

2E2

Isotype :

IgG2a,k

Desc1 :

Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
ILKMGPVDKRKGLFARRRQLLLTEGPHLYYVDPVNKVLK
GEIPWSQELRPEAKNFKTFFVHTPNRTYYLMDPSGNAHK
WCRKIQEVWRQRYQSHPDAAVQ
PDK1 or PDPK1 is a 63kD monomeric protein which is also known as Akt kinase. PDK1 is composed of a C-terminal PH (pleckstrin homology) domain and an N-terminal catalytic domain. In response to insulin or insulin-like growth factor, PDK1 phosphorylates PKB/Akt1 on threonine 308 and serine 473 in a phosphatidylinositol 3,4,5-triphosphate or phosphatidylinositol 3,4-biphosphate-dependent manner. Phosphatidylinositol 3,4,5-triphosphate or phosphatidylinositol 3,4-biphosphate binds to the PH domains of PKB and PDK1 resulting in the translocation of these proteins to the cell membrane and activation of PKB. PDK1 also phosphorylates the 70kD ribosomal protein S6 kinase at threonine 229, which is required for its activation. Thus, PDK1 acts upstream of PKB and has been shown to control signals for proliferation and apoptosis. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence:

Calc Crossreactivity :

Hu Rt

Immunogen :

Partial recombinant corresponding to aa457-557 from human PDPK1 (NP_002604) with GST tag. MW of the GST tag alone is 26kD.

Specificity :

Recognizes human PDPK1. Species Crossreactivity: rat.

Purity :

Purified by Protein A affinity chromatography.

Form :

Supplied as a liquid in PBS, pH 7.2.

Concentration :

As reported

Desc2 :

Product Type: Mab Isotype: IgG2a,k Clone No: 2E2 Host: mouse Source: human Concentration: As reported Form: Supplied as a liquid in PBS, pH 7.2. Purity: Purified by Protein A affinity chromatography. Immunogen: Partial recombinant corresponding to aa457-557 from human PDPK1 (NP_002604) with GST tag. MW of the GST tag alone is 26kD. Specificity: Recognizes human PDPK1. Species Crossreactivity: rat. Important Note: This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.

Calc Applications Abbrev :

E WB

Storage Temperature :

-20°C

Picture 1 File Name :

https://usbio-images.r.worldssl.net/prodimages/25/131092_1.jpg

Picture4 Text :

Western Blot analysis of PDPK1 expression in transfected 293T cell line by PDPK1 monoclonal antibody. Lane 1: PDPK1 transfected lysate (Predicted MW: 48.2kD). Lane 2: Non-transfected lysate.