This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
US Biological
product type :
antibody
product name :
PDK1 (Pyruvate dehydrogenase kinase isoform 1)
catalog :
131089
quantity :
100 ug
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
reactivity :
human
product information
Catalog Number :
131089
Product wo Prefix :
PDK1 (Pyruvate dehydrogenase kinase isoform 1)
Host :
mouse
Product Type :
Mab
Category :
Antibodies
Size1 :
100 ug
Clone # USB :
3B7
Isotype :
IgG2b,k
Desc1 :
Storage and Stability:
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
GGKGKGSPSHRKHIGSINPNCNVLEVIKDGYENARRLCD
LYYINSPELELEELNAKSPGQPIQVVYVPSHLYHMVFEL
FKNAMRATMEHHANRGVYPPIQ
Pyruvate dehydrogenase (PDH) is a mitochondrial multienzyme complex that catalyzes the oxidative decarboxylation of pyruvate and is one of the major enzymes responsible for the regulation of homeostasis of carbohydrate fuels in mammals. The enzymatic activity is regulated by a phosphorylation/ dephosphorylation cycle. Phosphorylation of PDH by a specific pyruvate dehydrogenase kinase (PDK) results in inactivation. (provided by RefSeq). Tissue specificity: Expressed predominantly in the heart. Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence:
GGKGKGSPSHRKHIGSINPNCNVLEVIKDGYENARRLCD
LYYINSPELELEELNAKSPGQPIQVVYVPSHLYHMVFEL
FKNAMRATMEHHANRGVYPPIQ
Pyruvate dehydrogenase (PDH) is a mitochondrial multienzyme complex that catalyzes the oxidative decarboxylation of pyruvate and is one of the major enzymes responsible for the regulation of homeostasis of carbohydrate fuels in mammals. The enzymatic activity is regulated by a phosphorylation/ dephosphorylation cycle. Phosphorylation of PDH by a specific pyruvate dehydrogenase kinase (PDK) results in inactivation. (provided by RefSeq). Tissue specificity: Expressed predominantly in the heart. Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence:
Calc Crossreactivity :
Hu
Immunogen :
Partial recombinant corresponding to aa203-302 from human PDK1 (AAH39158) with GST tag. MW of the GST tag alone is 26kD.
Specificity :
Recognizes human PDK1.
Purity :
Purified by Protein A affinity chromatography.
Form :
Supplied as a liquid in PBS, pH 7.2.
Concentration :
As reported
Desc2 :
Product Type: Mab
Isotype: IgG2b,k
Clone No: 3B7
Host: mouse
Source: human
Concentration: As reported
Form: Supplied as a liquid in PBS, pH 7.2.
Purity: Purified by Protein A affinity chromatography.
Immunogen: Partial recombinant corresponding to aa203-302 from human PDK1 (AAH39158) with GST tag. MW of the GST tag alone is 26kD.
Specificity: Recognizes human PDK1.
Important Note: This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.
Calc Applications Abbrev :
E
Storage Temperature :
-20°C
Picture 1 File Name :
https://usbio-images.r.worldssl.net/prodimages/12/131089_1.jpg
company information
US Biological
4 Technology Way
Salem, MA01970
Salem, MA01970
service@usbio.net
https://www.usbio.net800-520-3011
headquarters: USA
United States Biological is a primary brand for the Life Science Industry. We are committed to reducing the cost of research with value, integrity and a truly personal buying experience.
questions and comments