product summary
Loading...
company name :
StressMarq Biosciences
product type :
protein
product name :
Alpha Synuclein E114C Mutant Pre-formed Fibrils: ATTO 488
catalog :
SPR-518-A488
quantity :
100 µg
more info or order :
image
image 1 :

Neuronal uptake of ATTO-488 conjugated Alpha Synuclein E114C Pre-Formed Fibril (PFFs) (SPR-518) visible by fluorescence after Trypan Blue quenching. Neurons expressing mCherry via AAVs (division 19) were treated with SPR-518 and then Trypan Blue to quench extracellular PFF fluorescence. ATTO-488 fluorescence present after (bottom row) Trypan Blue addition is from internalized PFFs. Note: greater mCherry signal post-Trypan Blue addition attributed to overlap of excitation/emission spectra (mCherry maxima ex 587/em610, Trypan Blue ex maxima 560/em630).
image 2 :

Representative TEM image of ATTO-488 conjugated Alpha Synuclein E114C Pre-Formed Fibrils (SPR-518), 500nm scale. Negative stain transmission electron microscopy images of SPR-518 acquired at 80 Kv on carbon coated 400 mesh copper grids using phosphotungstic acid and uranyl acetate stain.
image 3 :

Representative TEM image of ATTO-488 conjugated Alpha Synuclein E114C Pre-Formed Fibrils (SPR-518), 200nm scale. Negative stain transmission electron microscopy images of SPR-518 acquired at 80 Kv on carbon coated 400 mesh copper grids using phosphotungstic acid and uranyl acetate stain.
product information
Catalog No :
SPR-518-A488
Product Name :
Alpha Synuclein E114C Mutant Pre-formed Fibrils: ATTO 488
Description :
Human Recombinant Alpha Synuclein E114C Mutant PFFs: ATTO 488
Size :
100 µg
Research Area(s) :
Neuroscience Neurodegeneration Alzheimer's Disease Tangles & Tau Neuroscience Neurodegeneration Parkinson's Disease Synuclein Neuroscience Neurodegeneration Multiple System Atrophy
Alternative Name(s) :
Alpha Synuclein E114C, Alpha-synuclein, Alpha synuclein, Non-A beta component of AD amyloid, Non-A4 component of amyloid precursor, NACP, SNCA, PARK1, SYN, PD1, PARK4, Synuclein Alpha, Asyn, Alpha Synuclein PFFs, ATTO labelled Alpha Synuclein fibrils
Category :
Protein
Nature :
Recombinant
Swiss-Prot :
P37840
Applications :
WB Native PAGE In vitro Assay In vivo Assay
Species :
Human
Expression System :
E. coli
Protein Length :
140 aa
Amino Acid Sequence :
90% of mixture (wildtype):
MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA
MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLY
VGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVA
QKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILCDMP
VDPDNEAYEMPSEEGYQDYEPEA
10% of mixture (mutant conjugated form):
MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLY
VGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVA
QKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILCDMP
VDPDNEAYEMPSEEGYQDYEPEA
10% of mixture (mutant conjugated form):
Purity :
>95%
Protein Size :
14.434 kDa
Conjugate :
ATTO 488
more info or order :
company information

StressMarq Biosciences
PO Box 55036 CADBORO BAY
3825 Cadboro Bay Road
Victoria BC V8N 4G0
3825 Cadboro Bay Road
Victoria BC V8N 4G0
info@stressmarq.com
http://www.stressmarq.com1-250-294-9065
headquarters: canada
StressMarq Biosciences Inc. is a bioreagents company producing high-quality antibodies, antibody conjugates, proteins, assay kits, and small molecules for the life sciences.
With over 17,000 products, we offer a wide range of products for scientists in cancer, neuroscience, epigenetics, cell signalling, and cellular stress research areas.
Based in Victoria, BC, with a small but dedicated group of scientists, StressMarq provides highly-validated products that are sold with our quality guarantee, and supported by our years of scientific expertise. Our products are available in over 50 countries through our extensive distributor network.
StressMarq draws on scientific excellence from around the globe. We strive to partner with academic or for-profit institutions through licensing agreements to bring cutting-edge research tools to the scientific community.
With over 17,000 products, we offer a wide range of products for scientists in cancer, neuroscience, epigenetics, cell signalling, and cellular stress research areas.
Based in Victoria, BC, with a small but dedicated group of scientists, StressMarq provides highly-validated products that are sold with our quality guarantee, and supported by our years of scientific expertise. Our products are available in over 50 countries through our extensive distributor network.
StressMarq draws on scientific excellence from around the globe. We strive to partner with academic or for-profit institutions through licensing agreements to bring cutting-edge research tools to the scientific community.
