product summary
Loading...
company name :
StressMarq Biosciences
product type :
protein
product name :
Alpha Synuclein E114C Mutant Monomers: ATTO 488
catalog :
SPR-517-A488
quantity :
100 µg
image
image 1 :
StressMarq Biosciences SPR-517-A488 image 1
Purity and fluorescent signal of alpha-synuclein E114C-ATTO-488 monomers (SPR-517). Left: SDS-PAGE analysis of SPR-517 monomers on a 12% Bis-Tris gel (left). Right: SPR-517 concentration and fluorescence (excitation 488nm, emission 521 nm) exhibit a linear relationship at all concentrations tested (250 ng/mL - 500 µg/mL).
image 2 :
StressMarq Biosciences SPR-517-A488 image 2
Fibril formation of ATTO-488 conjugated alpha-synuclein E114C monomers (SPR-517). Fibrils were generated from a mixture of 10% E114C-ATTO-488 conjugated monomers and 90% wild-type monomers shaken 1000 rpm at 37oC for seven days in 1X PBS pH 7.4. Prior to measurement, a sample was taken, diluted to 0.5 mg/mL in 1X PBS pH 7.4 with 25 µM ThT and mixed. Excitation 450nm, emission 485 nm. Note: overall fibril ThT signal is dampened due to overlapping Atto-488 absorption maxima with ThT emission maxima.
image 3 :
StressMarq Biosciences SPR-517-A488 image 3
Fibril formation of ATTO-488 conjugated alpha-synuclein E114C monomers (SPR-517). Fibrils were generated from a mixture of 10% E114C-ATTO-488 conjugated monomers and 90% wild-type monomers shaken 1000 rpm at 37oC for seven days in 1X PBS pH 7.4. Prior to measurement, a sample was taken, diluted to 0.5 mg/mL in 1X PBS pH 7.4 with 25 µM ThT and mixed. Excitation 450nm, emission 485 nm. Note: overall fibril ThT signal is dampened due to overlapping Atto-488 absorption maxima with ThT emission maxima.
product information
Catalog No :
SPR-517-A488
Product Name :
Alpha Synuclein E114C Mutant Monomers: ATTO 488
Description :
Human Recombinant Alpha Synuclein E114C Mutant Monomers: ATTO 488
Size :
100 µg
Research Area(s) :
Neuroscience Neurodegeneration Alzheimer's Disease Tangles & Tau Neuroscience Neurodegeneration Parkinson's Disease Synuclein Neuroscience Neurodegeneration Multiple System Atrophy
Alternative Name(s) :
Alpha synuclein monomer, Alpha-synuclein monomer, Alpha synuclein protein monomer, Alpha synuclein monomer, Alpha-synuclein protein, Non-A beta component of AD amyloid protein, Non-A4 component of amyloid precursor protein, NACP protein, SNCA protein, NACP protein, PARK1 protein, Alpha synuclein monomers, SYN protein, Parkinson's disease familial 1 Protein
Category :
Protein
Nature :
Recombinant
Swiss-Prot :
P37840
Applications :
WB Native PAGE In vitro Assay In vivo Assay
Species :
Human
Expression System :
E.coli
Protein Length :
140 aa
Amino Acid Sequence :
MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLY
VGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVA
QKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILCDMP
VDPDNEAYEMPSEEGYQDYEPEA
Purity :
>95%
Protein Size :
14.434 kDa
Conjugate :
ATTO 488
company information
StressMarq Biosciences
PO Box 55036 CADBORO BAY
3825 Cadboro Bay Road
Victoria BC V8N 4G0
info@stressmarq.com
http://www.stressmarq.com
1-250-294-9065
headquarters: canada
StressMarq Biosciences Inc. is a bioreagents company producing high-quality antibodies, antibody conjugates, proteins, assay kits, and small molecules for the life sciences.
With over 17,000 products, we offer a wide range of products for scientists in cancer, neuroscience, epigenetics, cell signalling, and cellular stress research areas.
Based in Victoria, BC, with a small but dedicated group of scientists, StressMarq provides highly-validated products that are sold with our quality guarantee, and supported by our years of scientific expertise. Our products are available in over 50 countries through our extensive distributor network.
StressMarq draws on scientific excellence from around the globe. We strive to partner with academic or for-profit institutions through licensing agreements to bring cutting-edge research tools to the scientific community.