product summary
Loading...
company name :
StressMarq Biosciences
product type :
protein
product name :
Alpha Synuclein Monomers: Biotinylated
catalog :
SPR-507
quantity :
100 µg
more info or order :
product information
Catalog No :
SPR-507
Product Name :
Alpha Synuclein Monomers: Biotinylated
Description :
Human Recombinant Alpha Synuclein Monomers: Biotinylated (C-terminus)
Size :
100 µg
Research Area(s) :
Neuroscience Neurodegeneration Alzheimer's Disease Tangles & Tau Neuroscience Neurodegeneration Parkinson's Disease Synuclein Neuroscience Neurodegeneration Multiple System Atrophy
Alternative Name(s) :
Alpha synuclein monomer, Alpha-synuclein monomer, Alpha synuclein protein monomer, Alpha synuclein monomer, Alpha-synuclein protein, Non-A beta component of AD amyloid protein, Non-A4 component of amyloid precursor protein, NACP protein, SNCA protein, NACP protein, PARK1 protein, Alpha synuclein monomers, SYN protein, Parkinson disease familial 1 Protein
Category :
Protein
Nature :
Recombinant
Swiss-Prot :
P37840
Applications :
WB SDS PAGE In vitro Assay In vivo Assay
Species :
Human
Expression System :
E. coli
Protein Length :
155 aa
Amino Acid Sequence :
GVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQL GKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEAGLNDIFEAQK IEWHE
MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLY
VGSKTKEGVVH
MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLY
VGSKTKEGVVH
Purity :
>95% based on SDS-PAGE and nanodrop analysis.
Protein Size :
16.27 kDa
Conjugate :
C-terminal 15 amino acid tag: biotinylated
more info or order :
company information

StressMarq Biosciences
PO Box 55036 CADBORO BAY
3825 Cadboro Bay Road
Victoria BC V8N 4G0
3825 Cadboro Bay Road
Victoria BC V8N 4G0
info@stressmarq.com
http://www.stressmarq.com1-250-294-9065
headquarters: canada
StressMarq Biosciences Inc. is a bioreagents company producing high-quality antibodies, antibody conjugates, proteins, assay kits, and small molecules for the life sciences.
With over 17,000 products, we offer a wide range of products for scientists in cancer, neuroscience, epigenetics, cell signalling, and cellular stress research areas.
Based in Victoria, BC, with a small but dedicated group of scientists, StressMarq provides highly-validated products that are sold with our quality guarantee, and supported by our years of scientific expertise. Our products are available in over 50 countries through our extensive distributor network.
StressMarq draws on scientific excellence from around the globe. We strive to partner with academic or for-profit institutions through licensing agreements to bring cutting-edge research tools to the scientific community.
With over 17,000 products, we offer a wide range of products for scientists in cancer, neuroscience, epigenetics, cell signalling, and cellular stress research areas.
Based in Victoria, BC, with a small but dedicated group of scientists, StressMarq provides highly-validated products that are sold with our quality guarantee, and supported by our years of scientific expertise. Our products are available in over 50 countries through our extensive distributor network.
StressMarq draws on scientific excellence from around the globe. We strive to partner with academic or for-profit institutions through licensing agreements to bring cutting-edge research tools to the scientific community.
