product summary
Loading...
company name :
StressMarq Biosciences
product type :
protein
product name :
Alpha Synuclein S129A Mutant Pre-formed Fibrils
catalog :
SPR-506
quantity :
100 µg
more info or order :
image
image 1 :

TEM of human alpha synuclein S129A fibrils (SPR-506). Negative stain transmission electron microscopy images acquired at 80 Kv on carbon coated 400 mesh copper grids using phosphotungstic acid and uranyl acetate stain. Scale bar = 200 nm.
image 2 :

SDS-PAGE of purified human alpha synuclein S129A fibrils (SPR-506) on a 12% Bis-Tris Gel. 2ug and 4ug of total protein were loaded into the respective lanes. Electrophoresis was run at 200V for 45 minutes with fixed voltage using 1X MES running buffer.
image 3 :

Seeding activity of human alpha synuclein S129A mutant measured by ThT in vitro. Human alpha synuclein S129A fibrils (SPR-506) will rapidly seed both wild-type and S129A alpha synuclein monomers (SPR-505) with comparable activity to wild-type fibrils.
product information
Catalog No :
SPR-506
Product Name :
Alpha Synuclein S129A Mutant Pre-formed Fibrils
Description :
Human Recombinant Alpha Synuclein S129A Mutant PFFs
Size :
100 µg
Research Area(s) :
Neuroscience Neurodegeneration Alzheimer's Disease Tangles & Tau Neuroscience Neurodegeneration Parkinson's Disease Synuclein Neuroscience Neurodegeneration Multiple System Atrophy
Alternative Name(s) :
Alpha synuclein protein, Alpha-synuclein protein, Non-A beta component of AD amyloid protein, Non-A4 component of amyloid precursor protein, NACP protein, SNCA protein, NACP protein, PARK1 protein, SYN protein, Parkinson's disease familial 1 Protein, Alpha Synuclein S129A
Category :
Protein
Nature :
Recombinant
Swiss-Prot :
P37840-1
Applications :
WB SDS PAGE In vitro Assay
Species :
Human
Expression System :
E. coli
Protein Length :
Full length (1 - 140 aa)
Amino Acid Sequence :
MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLY
VGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVA
QKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMP
VDPDNEAYEMPAEEGYQDYEPEA
VGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVA
QKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMP
VDPDNEAYEMPAEEGYQDYEPEA
Purity :
>95%
Protein Size :
14.44 kDa
Conjugate :
No Tag
more info or order :
company information

StressMarq Biosciences
PO Box 55036 CADBORO BAY
3825 Cadboro Bay Road
Victoria BC V8N 4G0
3825 Cadboro Bay Road
Victoria BC V8N 4G0
info@stressmarq.com
http://www.stressmarq.com1-250-294-9065
headquarters: canada
StressMarq Biosciences Inc. is a bioreagents company producing high-quality antibodies, antibody conjugates, proteins, assay kits, and small molecules for the life sciences.
With over 17,000 products, we offer a wide range of products for scientists in cancer, neuroscience, epigenetics, cell signalling, and cellular stress research areas.
Based in Victoria, BC, with a small but dedicated group of scientists, StressMarq provides highly-validated products that are sold with our quality guarantee, and supported by our years of scientific expertise. Our products are available in over 50 countries through our extensive distributor network.
StressMarq draws on scientific excellence from around the globe. We strive to partner with academic or for-profit institutions through licensing agreements to bring cutting-edge research tools to the scientific community.
With over 17,000 products, we offer a wide range of products for scientists in cancer, neuroscience, epigenetics, cell signalling, and cellular stress research areas.
Based in Victoria, BC, with a small but dedicated group of scientists, StressMarq provides highly-validated products that are sold with our quality guarantee, and supported by our years of scientific expertise. Our products are available in over 50 countries through our extensive distributor network.
StressMarq draws on scientific excellence from around the globe. We strive to partner with academic or for-profit institutions through licensing agreements to bring cutting-edge research tools to the scientific community.
related products
browse more products
questions and comments