product summary
Loading...
company name :
StressMarq Biosciences
product type :
protein
product name :
Alpha Synuclein TNG (A53T, S87N, N103G) Mutant Monomers
catalog :
SPR-503
quantity :
100 µg
image
image 1 :
StressMarq Biosciences SPR-503 image 1
SDS-PAGE of purified human alpha synuclein TNG (A53T, S87N, N103G) monomer (SPR-503) on a 12% Bis-Tris Gel. 2ug and 4ug of total protein were loaded into the respective lanes. Electrophoresis was run at 200V for 45 minutes with fixed voltage using 1X MES running buffer.
image 2 :
StressMarq Biosciences SPR-503 image 2
Fibril formation and seeding activity of human alpha synuclein TNG mutant measured by ThT in vitro. Human TNG mutant monomers (SPR-503) self-aggregate faster than human wild-type monomers. Human TNG mutant pre-formed fibrils (SPR-504) rapidly seed mouse wild-type monomers, but not human wild-type monomers, similar to the seeding pattern observed for mouse wild-type pre-formed fibrils.
image 3 :
StressMarq Biosciences SPR-503 image 3
Fibril formation and seeding activity of human alpha synuclein TNG mutant measured by ThT in vitro. Human TNG mutant monomers (SPR-503) self-aggregate faster than human wild-type monomers. Human TNG mutant pre-formed fibrils (SPR-504) rapidly seed mouse wild-type monomers, but not human wild-type monomers, similar to the seeding pattern observed for mouse wild-type pre-formed fibrils.
product information
Catalog No :
SPR-503
Product Name :
Alpha Synuclein TNG (A53T, S87N, N103G) Mutant Monomers
Description :
Human Recombinant Alpha Synuclein TNG (A53T, S87N, N103G) Mutant Monomers
Size :
100 µg
Research Area(s) :
Neuroscience Neurodegeneration Alzheimer's Disease Tangles & Tau Neuroscience Neurodegeneration Parkinson's Disease Synuclein Neuroscience Neurodegeneration Multiple System Atrophy
Alternative Name(s) :
Alpha synuclein protein, Alpha-synuclein protein, Non-A beta component of AD amyloid protein, Non-A4 component of amyloid precursor protein, NACP protein, SNCA protein, NACP protein, PARK1 protein, SYN protein, Parkinson's disease familial 1 Protein, Alpha Synuclein TNG
Category :
Protein
Nature :
Recombinant
Swiss-Prot :
P37840-1
Applications :
WB SDS PAGE In vitro Assay
Species :
Human
Expression System :
E. coli
Protein Length :
Full length (1 - 140 aa)
Amino Acid Sequence :
MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLY
VGSKTKEGVVHGVTTVAEKTKEQVTNVGGAVVTGVTAVA
QKTVEGAGNIAAATGFVKKDQLGKGEEGAPQEGILEDMP
VDPDNEAYEMPSEEGYQDYEPEA
Purity :
>95%
Protein Size :
14.46 kDa
Conjugate :
No Tag
company information
StressMarq Biosciences
PO Box 55036 CADBORO BAY
3825 Cadboro Bay Road
Victoria BC V8N 4G0
info@stressmarq.com
http://www.stressmarq.com
1-250-294-9065
headquarters: canada
StressMarq Biosciences Inc. is a bioreagents company producing high-quality antibodies, antibody conjugates, proteins, assay kits, and small molecules for the life sciences.
With over 17,000 products, we offer a wide range of products for scientists in cancer, neuroscience, epigenetics, cell signalling, and cellular stress research areas.
Based in Victoria, BC, with a small but dedicated group of scientists, StressMarq provides highly-validated products that are sold with our quality guarantee, and supported by our years of scientific expertise. Our products are available in over 50 countries through our extensive distributor network.
StressMarq draws on scientific excellence from around the globe. We strive to partner with academic or for-profit institutions through licensing agreements to bring cutting-edge research tools to the scientific community.