product summary
Loading...
company name :
StressMarq Biosciences
product type :
protein
product name :
Tau dGAE (297-391) Monomers
catalog :
SPR-501
quantity :
100 µg
image
image 1 :
StressMarq Biosciences SPR-501 image 1
SDS-PAGE of purified E. coli expressed hTau (dGAE) (SPR-501) on a 12% Tris-Glycine gel.
image 2 :
StressMarq Biosciences SPR-501 image 2
TEM of Tau dGAE AD-mimic fibrils (SPR-502) generated from Tau dGAE monomers (SPR-501) by shaking 200 rpm at 37oC for 48 hours in 10 mM PB 10 mM DTT pH 7.4 with 200 mM MgCl2 added (Lovestam et al. 2022, eLife). Negative stain transmission electron microscopy images acquired at 80 Kv on carbon coated 400 mesh copper grids using phosphotungstic acid and uranyl acetate stain. Scale bar = 200 nm.
image 3 :
StressMarq Biosciences SPR-501 image 3
TEM of Tau dGAE AD-mimic fibrils (SPR-502) generated from Tau dGAE monomers (SPR-501) by shaking 200 rpm at 37oC for 48 hours in 10 mM PB 10 mM DTT pH 7.4 with 200 mM MgCl2 added (Lovestam et al. 2022, eLife). Negative stain transmission electron microscopy images acquired at 80 Kv on carbon coated 400 mesh copper grids using phosphotungstic acid and uranyl acetate stain. Scale bar = 200 nm.
product information
Catalog No :
SPR-501
Product Name :
Tau dGAE (297-391) Monomers
Description :
Human Recombinant Tau dGAE (297-391) Monomers
Size :
100 µg
Research Area(s) :
Alzheimer's Disease Axon Markers Cell Markers Cell Signaling Cytoskeleton Microtubules MT Associated Proteins Neurodegeneration Neuron Markers Neuroscience Tangles & Tau
Alternative Name(s) :
Tau monomer, Tau protein monomer, Tau protein, microtubule-associated protein Tau, MAPT, MAP, microtubule-associated protein, Truncated Tau Protein Monomer, Paired Helical Filament-Tau, Phf-Tau, Neurofibrillary Tangle Protein, Tau dGAE Protein, dGAE
Category :
Protein
Nature :
Recombinant
Swiss-Prot :
P10636-8
Applications :
WB SDS PAGE In vitro Assay
Species :
Human
Expression System :
E. coli
Protein Length :
Fragment of full length wild-type Tau 2N4R (297 - 391aa)
Amino Acid Sequence :
MIKHVPGGGSVQIVYKPVDLSKVTSKCGSLGNIHHKPGG
GQVEVKSEKLDFKDRVQSKIGSLDNITHVPGGGNKKIET
HKLTFRENAKAKTDHGAE
Purity :
>95%
Protein Size :
10.165 kDa
Conjugate :
No Tag
company information
StressMarq Biosciences
PO Box 55036 CADBORO BAY
3825 Cadboro Bay Road
Victoria BC V8N 4G0
info@stressmarq.com
http://www.stressmarq.com
1-250-294-9065
headquarters: canada
StressMarq Biosciences Inc. is a bioreagents company producing high-quality antibodies, antibody conjugates, proteins, assay kits, and small molecules for the life sciences.
With over 17,000 products, we offer a wide range of products for scientists in cancer, neuroscience, epigenetics, cell signalling, and cellular stress research areas.
Based in Victoria, BC, with a small but dedicated group of scientists, StressMarq provides highly-validated products that are sold with our quality guarantee, and supported by our years of scientific expertise. Our products are available in over 50 countries through our extensive distributor network.
StressMarq draws on scientific excellence from around the globe. We strive to partner with academic or for-profit institutions through licensing agreements to bring cutting-edge research tools to the scientific community.