product summary
Loading...
company name :
StressMarq Biosciences
product type :
protein
product name :
Amyloid Beta Pyroglutamate 3-42 Pre-formed Fibrils
catalog :
SPR-492
quantity :
100 µg
more info or order :
citations: 2
Reference |
---|
image
image 1 :

AFM of amyloid beta pyroglutamate 3-42 fibrils (catalog# SPR-492). Atomic force microscopy analysis of 1.0 mg/mL samples diluted to 0.1 mg/mL in 2% DMSO + 10 mM HCl, mounted on freshly cleaved mica, washed, dried and analyzed with tapping mode. Representative images are 10 x 10 µm x-y (left) and 5 x 5 µm x-y (middle) and 2 x 2 µm x-y (right), all with a z-range of 6 nm.
image 2 :

Western blot of amyloid beta pyroglutamate 3-42 fibrils (catalog# SPR-492) using anti-amyloid beta 6E10 antibody. Amyloid beta pyroglutamate 3-42 at 160 pmol was run on 4-12% Bis-Tris SDS-PAGE, transferred to nitrocellulose in the presence of 0.02% v/v Tween-20, and blotted with 1:1000 mouse 6E10 primary antibody (Biolegend). Compared to monomers re-suspended in 2% DMSO and immediately run on SDS-PAGE, fibrils show monomer depletion, a signal from 37 kDa upwards and a distinct signal in the stacking gel. MW ladder = Precision Plus Dual Xtra prestained standards.
product information
Catalog No :
SPR-492
Product Name :
Amyloid Beta Pyroglutamate 3-42 Pre-formed Fibrils
Description :
Human Amyloid Beta Pyroglutamate 3-42 Pre-formed Fibrils
Size :
100 µg
Research Area(s) :
Neuroscience Neurodegeneration Alzheimer's Disease Amyloid
Alternative Name(s) :
pyro abeta, pyro amyloid beta, Abeta, Amyloid beta peptide, Beta amyloid peptide, amyloid beta precursor protein peptide, pyroglutamate amyloid beta, AβPE3, APP
Category :
Protein
Nature :
Synthetic (TFA preparation, HFIP treated precursor)
Swiss-Prot :
P05067
Applications :
WB In vivo Assay In vitro Assay
Species :
Human
Protein Length :
40 amino acids
Amino Acid Sequence :
pyroEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVG
GVVIA
GVVIA
Purity :
>95%
Protein Size :
4.3 kDa
Conjugate :
No Tag
Cellular Localization :
Cell Membrane Intracellular Vesicles
more info or order :
company information

StressMarq Biosciences
PO Box 55036 CADBORO BAY
3825 Cadboro Bay Road
Victoria BC V8N 4G0
3825 Cadboro Bay Road
Victoria BC V8N 4G0
info@stressmarq.com
http://www.stressmarq.com1-250-294-9065
headquarters: canada
StressMarq Biosciences Inc. is a bioreagents company producing high-quality antibodies, antibody conjugates, proteins, assay kits, and small molecules for the life sciences.
With over 17,000 products, we offer a wide range of products for scientists in cancer, neuroscience, epigenetics, cell signalling, and cellular stress research areas.
Based in Victoria, BC, with a small but dedicated group of scientists, StressMarq provides highly-validated products that are sold with our quality guarantee, and supported by our years of scientific expertise. Our products are available in over 50 countries through our extensive distributor network.
StressMarq draws on scientific excellence from around the globe. We strive to partner with academic or for-profit institutions through licensing agreements to bring cutting-edge research tools to the scientific community.
With over 17,000 products, we offer a wide range of products for scientists in cancer, neuroscience, epigenetics, cell signalling, and cellular stress research areas.
Based in Victoria, BC, with a small but dedicated group of scientists, StressMarq provides highly-validated products that are sold with our quality guarantee, and supported by our years of scientific expertise. Our products are available in over 50 countries through our extensive distributor network.
StressMarq draws on scientific excellence from around the globe. We strive to partner with academic or for-profit institutions through licensing agreements to bring cutting-edge research tools to the scientific community.
related products
browse more products
questions and comments