product summary
Loading...
company name :
StressMarq Biosciences
product type :
protein
product name :
Tau-352 (fetal 0N3R) Wild-Type Pre-formed Fibrils
catalog :
SPR-491
quantity :
100 µg
citations: 4
Reference
Zhan X, Li W, Hatterer E, Courade J, Pich xe9 K, Klementieva O, et al. Strain-Distinct α-Synuclein and Tau Cross-Seeding Uncovered by Correlative Approach with Optical Photothermal Infrared Sub-Micron Imaging. J Am Chem Soc. 2025;147:27323-27340 pubmed publisher
Desai A, Zupancic J, Trzeciakiewicz H, Gerson J, DuBois K, Skinner M, et al. Facile generation of drug-like conformational antibodies specific for amyloid fibrils. Nat Chem Biol. 2025;21:916-925 pubmed publisher
Desai A, Zupancic J, Trzeciakiewicz H, Gerson J, DuBois K, Skinner M, et al. Flow cytometric isolation of drug-like conformational antibodies specific for amyloid fibrils. bioRxiv. 2023;: pubmed publisher
Chen K, Martens Y, Meneses A, Ryu D, Lu W, Raulin A, et al. LRP1 is a neuronal receptor for α-synuclein uptake and spread. Mol Neurodegener. 2022;17:57 pubmed publisher
image
image 1 :
StressMarq Biosciences SPR-491 image 1
AFM of Fetal Tau 0N3R fibrils. Atomic force microscopy analysis of 1.0 mg/mL samples diluted to 0.1 mg/mL in dH2O, mounted on freshly cleaved mica, washed, dried and analyzed with tapping mode. Representative images are 10 x 10 µm x-y (left) and 2 x 2 µm x-y (right) both with a z-range of 6 nm. Note: AFM images display significant twisting and curvature not observed under TEM.
image 2 :
StressMarq Biosciences SPR-491 image 2
Tris-glycine SDS-PAGE (12%) of Fetal Tau 0N3R monomers. MW ladder = Precision Plus Protein All Blue prestained standards.
product information
Catalog No :
SPR-491
Product Name :
Tau-352 (fetal 0N3R) Wild-Type Pre-formed Fibrils
Description :
Human Recombinant Tau-352 (fetal 0N3R) Wild-Type PFFs
Size :
100 µg
Research Area(s) :
Alzheimer's Disease Axon Markers Cell Markers Cell Signaling Cytoskeleton Microtubules MT Associated Proteins Neurodegeneration Neuron Markers Neuroscience Tangles & Tau
Alternative Name(s) :
Tau aggregate, Tau protein, microtubule-associated protein Tau, MAPT, MAP, microtubule-associated protein, Truncated Tau Protein Aggregate, Paired Helical Filament- Tau, Phf-Tau, Neurofibrillary Tangle Protein, G Protein Beta1/Gamma2 Subunit-Interacting Factor 1, Isoform 2, tubulin-associated unit, 95-amino acid Tau protein fragment, Truncated Tau
Category :
Protein
Nature :
Recombinant
Accession Number :
NP_058525.1
Swiss-Prot :
P10636-2
Applications :
WB SDS-PAGE In vitro Assay
Species :
Human
Expression System :
E. coli
Protein Length :
Full Length (1-352 aa)
Amino Acid Sequence :
MAEPRQEFEVMEDHAGTYGLGDRKDQGGYTMHQDQEGDT
DAGLKAEEAGIGDTPSLEDEAAGHVTQARMVSKSKDGTG
SDDKKAKGADGKTKIATPRGAAPPGQKGQANATRIPAKT
PPAPKTPPSSGEPPKSGDRSGYSSPGSPGTPGSRSRTPS
LPTPPTREPKKVAVVRTPPKSPSSAKSRLQTAPVPMPDL
KNVKSKIGSTENLKHQPGGGKVQIVYKPVDLSKVTSKCG
SLGNIHHKPGGGQVEVKSEKLDFKDRVQSKIGSLDNITH
VPGGGNKKIETHKLTFRENAKAKTDHGAEIVYKSPVVSG
DTSPRHLSNVSSTGSIDMVDSPQLATLADEVSASLAKQG
L
Purity :
>95%
Protein Size :
37 kDa
Conjugate :
No Tag
Cellular Localization :
Axolemma Axolemma Plasma Membrane Axon Cell Body Cell membrane Cytoplasm Cytoplasmic Ribonucleoprotein Granule Cytoplasmic Side Cytoskeleton Cytosol Dendrite Growth cone Microtubule Microtubule Associated Complex Neurofibrillary Tangle Neuronal Cell Body Nuclear Periphery Nuclear Speck Nucleus Peripheral membrane protein Plasma Membrane Tubulin complex
company information
StressMarq Biosciences
PO Box 55036 CADBORO BAY
3825 Cadboro Bay Road
Victoria BC V8N 4G0
info@stressmarq.com
http://www.stressmarq.com
1-250-294-9065
headquarters: canada
StressMarq Biosciences Inc. is a bioreagents company producing high-quality antibodies, antibody conjugates, proteins, assay kits, and small molecules for the life sciences.
With over 17,000 products, we offer a wide range of products for scientists in cancer, neuroscience, epigenetics, cell signalling, and cellular stress research areas.
Based in Victoria, BC, with a small but dedicated group of scientists, StressMarq provides highly-validated products that are sold with our quality guarantee, and supported by our years of scientific expertise. Our products are available in over 50 countries through our extensive distributor network.
StressMarq draws on scientific excellence from around the globe. We strive to partner with academic or for-profit institutions through licensing agreements to bring cutting-edge research tools to the scientific community.