product summary
Loading...
company name :
StressMarq Biosciences
product type :
protein
product name :
Alpha Synuclein A90C Mutant Monomers
catalog :
SPR-478
quantity :
100 µg
more info or order :
citations: 1
image
image 1 :

Co-aggregation of AF594 and AF488-labelled A90C alpha-synuclein monomers. Half of monomers were labelled with AF594 and half with AF488, and then allowed to aggregate prior to imaging using (A) total internal reflection microscopy (TIRFM) at the two excitation and emission maxima and (B) single-molecule confocal FRET detection of two oligomer types at Ex488 and Em594. In depth method and oligomer details were previously described by Horrocks et al. in 2015 (https://doi.org/10.1021/acs.analchem.5b01811).
image 2 :

Coomassie stain SDS gel analysis of E coli expressed human alpha synuclein A90C monomer showing the protein purity. Lane 1: Biorad All Blue Standards (3uL), Lane 2: E coli expressed human alpha synuclein A90C monomer (2ug), lane 3: E coli expressed human alpha synuclein A90C monomer (4ug).
image 3 :

Fibril formation human alpha synuclein A90C mutant measured by ThT in vitro. Human alpha synuclein A90C monomers form ThT-positive fibrils over the course of 7 days when shaken at 1000 rpm at 37oC.
product information
Catalog No :
SPR-478
Product Name :
Alpha Synuclein A90C Mutant Monomers
Description :
Human Recombinant Alpha Synuclein A90C Mutant Monomers
Size :
100 µg
Research Area(s) :
Neuroscience Neurodegeneration Alzheimer's Disease Tangles & Tau Neuroscience Neurodegeneration Parkinson's Disease Synuclein Neuroscience Neurodegeneration Multiple System Atrophy
Alternative Name(s) :
SNCA, alpha-synuclein, synuclein, Alpha synuclein monomer, Alpha-synuclein monomer, Alpha synuclein protein monomer, Alpha synuclein monomer, Alpha-synuclein protein, SNCA protein
Category :
Protein
Nature :
Recombinant
Swiss-Prot :
P37840-1 (wildtype)
Applications :
WB SDS PAGE In vitro Assay Conjugation FRET
Species :
Human
Expression System :
E. coli
Protein Length :
Full length (1 - 140 aa)
Amino Acid Sequence :
MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLY
VGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVA
QKTVEGAGSIACATGFVKKDQLGKNEEGAPQEGILEDMP
VDPDNEAYEMPSEEGYQDYEPEA
VGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVA
QKTVEGAGSIACATGFVKKDQLGKNEEGAPQEGILEDMP
VDPDNEAYEMPSEEGYQDYEPEA
Purity :
>95%
Protein Size :
14.49 kDa
Conjugate :
No Tag
more info or order :
company information

StressMarq Biosciences
PO Box 55036 CADBORO BAY
3825 Cadboro Bay Road
Victoria BC V8N 4G0
3825 Cadboro Bay Road
Victoria BC V8N 4G0
info@stressmarq.com
http://www.stressmarq.com1-250-294-9065
headquarters: canada
StressMarq Biosciences Inc. is a bioreagents company producing high-quality antibodies, antibody conjugates, proteins, assay kits, and small molecules for the life sciences.
With over 17,000 products, we offer a wide range of products for scientists in cancer, neuroscience, epigenetics, cell signalling, and cellular stress research areas.
Based in Victoria, BC, with a small but dedicated group of scientists, StressMarq provides highly-validated products that are sold with our quality guarantee, and supported by our years of scientific expertise. Our products are available in over 50 countries through our extensive distributor network.
StressMarq draws on scientific excellence from around the globe. We strive to partner with academic or for-profit institutions through licensing agreements to bring cutting-edge research tools to the scientific community.
With over 17,000 products, we offer a wide range of products for scientists in cancer, neuroscience, epigenetics, cell signalling, and cellular stress research areas.
Based in Victoria, BC, with a small but dedicated group of scientists, StressMarq provides highly-validated products that are sold with our quality guarantee, and supported by our years of scientific expertise. Our products are available in over 50 countries through our extensive distributor network.
StressMarq draws on scientific excellence from around the globe. We strive to partner with academic or for-profit institutions through licensing agreements to bring cutting-edge research tools to the scientific community.
