product summary
Loading...
company name :
StressMarq Biosciences
product type :
protein
product name :
Tau (K18) Delta K280 Mutant Monomers
catalog :
SPR-476
quantity :
100 µg
more info or order :
citations: 2
Reference |
---|
product information
Catalog No :
SPR-476
Product Name :
Tau (K18) Delta K280 Mutant Monomers
Description :
Human Recombinant Tau (K18) Delta K280 Mutant Monomers
Size :
100 µg
Research Area(s) :
Alzheimer's Disease Axon Markers Cell Markers Cell Signaling Cytoskeleton Microtubules MT Associated Proteins Neurodegeneration Neuron Markers Neuroscience Tangles & Tau
Alternative Name(s) :
Tau monomer, Tau protein monomer, Tau protein, microtubule-associated protein Tau, MAPT, MAP, microtubule-associated protein, Truncated Tau Protein Monomer, Paired Helical Filament-Tau, Phf-Tau, Neurofibrillary Tangle Protein, G Protein Beta1/Gamma2 Subunit-Interacting Factor 1, Isoform 2, tubulin-associated unit, 95-amino acid Tau protein fragment, Truncated Tau Protein, MAPT DeltaK280, K280 deletion Tau, K18 delta K280 Tau, truncated delta K280 Tau
Category :
Protein
Nature :
Recombinant
Swiss-Prot :
P10636
Applications :
WB SDS-PAGE In vivo assay In vitro assay
Species :
Human
Expression System :
E. coli
Protein Length :
Partial
Amino Acid Sequence :
MSRLQTAPVPMPDLKNVKSKIGSTENLKHQPGGGKVQII
NKLDLSNVQSKCGSKDNIKHVPGGGSVQIVYKPVDLSKV
TSKCGSLGNIHHKPGGGQVEVKSEKLDFKDRVQSKIGSL
DNITHVPGGGNKKIETHKLTFRE
NKLDLSNVQSKCGSKDNIKHVPGGGSVQIVYKPVDLSKV
TSKCGSLGNIHHKPGGGQVEVKSEKLDFKDRVQSKIGSL
DNITHVPGGGNKKIETHKLTFRE
Purity :
>95%
Protein Size :
~15 kDa
Conjugate :
No Tag
Cellular Localization :
Cytoplasm Axolemma Axolemma Plasma Membrane Axon Cell Body Cell membrane Cytoplasmic Ribonucleoprotein Granule Cytoplasmic Side Cytoskeleton Cytosol Dendrite Growth cone Microtubule Microtubule Associated Complex Neurofibrillary Tangle Neuronal Cell Body Nuclear Periphery Nuclear Speck Nucleus Peripheral membrane protein Plasma Membrane Tubulin Complex
more info or order :
company information

StressMarq Biosciences
PO Box 55036 CADBORO BAY
3825 Cadboro Bay Road
Victoria BC V8N 4G0
3825 Cadboro Bay Road
Victoria BC V8N 4G0
info@stressmarq.com
http://www.stressmarq.com1-250-294-9065
headquarters: canada
StressMarq Biosciences Inc. is a bioreagents company producing high-quality antibodies, antibody conjugates, proteins, assay kits, and small molecules for the life sciences.
With over 17,000 products, we offer a wide range of products for scientists in cancer, neuroscience, epigenetics, cell signalling, and cellular stress research areas.
Based in Victoria, BC, with a small but dedicated group of scientists, StressMarq provides highly-validated products that are sold with our quality guarantee, and supported by our years of scientific expertise. Our products are available in over 50 countries through our extensive distributor network.
StressMarq draws on scientific excellence from around the globe. We strive to partner with academic or for-profit institutions through licensing agreements to bring cutting-edge research tools to the scientific community.
With over 17,000 products, we offer a wide range of products for scientists in cancer, neuroscience, epigenetics, cell signalling, and cellular stress research areas.
Based in Victoria, BC, with a small but dedicated group of scientists, StressMarq provides highly-validated products that are sold with our quality guarantee, and supported by our years of scientific expertise. Our products are available in over 50 countries through our extensive distributor network.
StressMarq draws on scientific excellence from around the globe. We strive to partner with academic or for-profit institutions through licensing agreements to bring cutting-edge research tools to the scientific community.
related products
browse more products
questions and comments