product summary
Loading...
company name :
StressMarq Biosciences
product type :
protein
product name :
Alpha Synuclein Pre-formed Fibrils: ATTO 594 (Type 1)
catalog :
SPR-322-A594
quantity :
50 µg
more info or order :
citations: 2
Reference |
---|
product information
Catalog No :
SPR-322-A594
Product Name :
Alpha Synuclein Pre-formed Fibrils: ATTO 594 (Type 1)
Description :
Human Recombinant Alpha Synuclein Protein Pre-formed Fibrils: ATTO 594 (Type 1)
Size :
50 µg
Research Area(s) :
Neuroscience Neurodegeneration Alzheimer's Disease Tangles & Tau Neuroscience Neurodegeneration Parkinson's Disease Synuclein Neuroscience Neurodegeneration Multiple System Atrophy
Alternative Name(s) :
Alpha synuclein PFFs, Alpha synuclein aggregates, Alpha synuclein PFF, Alpha synuclein protein aggregates, Alpha synuclein aggregates, Alpha-synuclein protein, Non-A beta component of AD amyloid protein, Non-A4 component of amyloid precursor protein, NACP protein, SNCA protein, NACP protein, PARK1 protein, SYN protein, Parkinson's disease familial 1 Protein, Alpha synuclein protein seed, ATTO 594 conjugated alpha synuclein, ATTO labelled alpha synuclein fibrils
Category :
Protein
Nature :
Recombinant
Accession Number :
NP_000336.1
Swiss-Prot :
P37840
Applications :
WB SDS-PAGE In vivo assay In vitro assay
Species :
Human
Expression System :
E. coli
Protein Length :
Full Length
Amino Acid Sequence :
MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLY
VGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVA
QKTVEGAG
VGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVA
QKTVEGAG
Purity :
>95%
Conjugate :
ATTO 594
Cellular Localization :
Cytoplasm Membrane Nucleus
more info or order :
company information

StressMarq Biosciences
PO Box 55036 CADBORO BAY
3825 Cadboro Bay Road
Victoria BC V8N 4G0
3825 Cadboro Bay Road
Victoria BC V8N 4G0
info@stressmarq.com
http://www.stressmarq.com1-250-294-9065
headquarters: canada
StressMarq Biosciences Inc. is a bioreagents company producing high-quality antibodies, antibody conjugates, proteins, assay kits, and small molecules for the life sciences.
With over 17,000 products, we offer a wide range of products for scientists in cancer, neuroscience, epigenetics, cell signalling, and cellular stress research areas.
Based in Victoria, BC, with a small but dedicated group of scientists, StressMarq provides highly-validated products that are sold with our quality guarantee, and supported by our years of scientific expertise. Our products are available in over 50 countries through our extensive distributor network.
StressMarq draws on scientific excellence from around the globe. We strive to partner with academic or for-profit institutions through licensing agreements to bring cutting-edge research tools to the scientific community.
With over 17,000 products, we offer a wide range of products for scientists in cancer, neuroscience, epigenetics, cell signalling, and cellular stress research areas.
Based in Victoria, BC, with a small but dedicated group of scientists, StressMarq provides highly-validated products that are sold with our quality guarantee, and supported by our years of scientific expertise. Our products are available in over 50 countries through our extensive distributor network.
StressMarq draws on scientific excellence from around the globe. We strive to partner with academic or for-profit institutions through licensing agreements to bring cutting-edge research tools to the scientific community.
related products
browse more products
- Tau-441 (2N4R) P301S Mutant Pre-formed Fibrils: ATTO 488 | SPR-329-A488
- Alpha Synuclein Oligomers (Epigallocatechin gallate (EGCG) Stabilized)
- Tau-441 (2N4R) P301S Mutant Pre-formed Fibrils (Baculovirus/Sf9) | SPR-471
- Tau-441 (2N4R) P301S Mutant Monomers (Baculovirus/Sf9) | SPR-473
- Camostat mesylate | SIH-585
questions and comments