HSP90 beta Protein | StressMarq Biosciences SPR-102 product information

product summary

company name :

StressMarq Biosciences

product type :

protein

product name :

HSP90 beta Protein

catalog :

SPR-102

quantity :

50 µg

more info or order :

StressMarq Biosciences product webpage

citations: 13

Reference
Boyd J, Wang S, Lin H, Hsieh Y, Sun Y, Thibodeaux B, et al. Preclinical characterization of an active immunotherapy targeting calcitonin gene-related peptide. Commun Med (Lond). 2025;5:145 pubmed publisher
Ding X, Meng C, Dong H, Zhang S, Zhou H, Tan W, et al. Extracellular Hsp90α, which participates in vascular inflammation, is a novel serum predictor of atherosclerosis in type 2 diabetes. BMJ Open Diabetes Res Care. 2022;10: pubmed publisher
Gaonkar R, Shiralgi Y, Lakkappa D, Hegde G. Essential oil from Cymbopogon flexuosus as the potential inhibitor for HSP90. Toxicol Rep. 2018;5:489-496 pubmed publisher
Rozenberg P, Ziporen L, Gancz D, Saar Ray M, Fishelson Z. Cooperation between Hsp90 and mortalin/GRP75 in resistance to cell death induced by complement C5b-9. Cell Death Dis. 2018;9:150 pubmed publisher
Dong H, Le Y, Wang Y, Zhao H, Huang C, Hu Y, et al. Extracellular heat shock protein 90? mediates HDM-induced bronchial epithelial barrier dysfunction by activating RhoA/MLC signaling. Respir Res. 2017;18:111 pubmed publisher
Goode K, Petrov D, Vickman R, Crist S, Pascuzzi P, Ratliff T, et al. Targeting the Hsp90 C-terminal domain to induce allosteric inhibition and selective client downregulation. Biochim Biophys Acta Gen Subj. 2017;1861:1992-2006 pubmed publisher
Thomas F, Goode K, Rajwa B, Bieberich A, Avramova L, Hazbun T, et al. A Chemogenomic Screening Platform Used to Identify Chemotypes Perturbing HSP90 Pathways. SLAS Discov. 2017;22:706-719 pubmed publisher
de la Mare J, Jurgens T, Edkins A. Extracellular Hsp90 and TGFÎ² regulate adhesion, migration and anchorage independent growth in a paired colon cancer cell line model. BMC Cancer. 2017;17:202 pubmed publisher
Alagramam K, Gopal S, Geng R, Chen D, Nemet I, Lee R, et al. A small molecule mitigates hearing loss in a mouse model of Usher syndrome III. Nat Chem Biol. 2016;12:444-51 pubmed publisher
Lam C, Zhao W, Liu G, Cai W, Gardner G, Adly G, et al. HAX-1 regulates cyclophilin-D levels and mitochondria permeability transition pore in the heart. Proc Natl Acad Sci U S A. 2015;112:E6466-75 pubmed publisher
Hunter M, O Hagan K, Kenyon A, Dhanani K, Prinsloo E, Edkins A. Hsp90 binds directly to fibronectin (FN) and inhibition reduces the extracellular fibronectin matrix in breast cancer cells. PLoS ONE. 2014;9:e86842 pubmed publisher
Tsou Y, Lin Y, Chang H, Lin H, Shao H, Yu S, et al. Heat shock protein 90: role in enterovirus 71 entry and assembly and potential target for therapy. PLoS ONE. 2013;8:e77133 pubmed publisher
Prinsloo E, Kramer A, Edkins A, Blatch G. STAT3 interacts directly with Hsp90. IUBMB Life. 2012;64:266-73 pubmed publisher

image

image 1 :

SDS-PAGE of 90kDa Hsp90 beta protein (SPR-102). Lane 1: Molecular Weight Ladder (MW). Lane 2: Human HSP90 beta protein (SPR-101).

product information

Catalog No :

SPR-102

Product Name :

HSP90 beta Protein

Description :

Active Human Recombinant HSP90 beta Full Length Protein

Size :

50 µg

Research Area(s) :

Cancer Heat Shock Cell Signaling Protein Trafficking Chaperone Proteins Cancer Tumor Biomarkers

Alternative Name(s) :

FLJ26984 Protein, HSP84 Protein, HSP90 Protein, HSP90B Protein, HSPC2 Protein, HSPCB Protein

Category :

Protein

Nature :

Recombinant

Accession Number :

NP_031381.2

Swiss-Prot :

P08238

Applications :

WB SDS-PAGE Functional Assay ELISA Co-IP Surface Plasmon Resonance (SPR)

Species :

Human

Expression System :

Baculovirus/Sf9 cells

Protein Length :

Full Length

Amino Acid Sequence :

MPEEVHHGEEEVETFAFQAEIAQLMSLIINTFYSNKEIF
LRELISNASDALDKIRYESLTDPSKLDSGKELKIDIIPN
PQERTLTLVDTGIGMTKADLINNLGTIAKSGTKAFMEAL
QAGADISMIGQFGVGFYSAYLVAEKVVVITKHNDDEQYA
WESSAGGSFTVRADHGEPIGRGTKVILHLKEDQTEYLEE
RRVKEVVKKHSQFIGYPITLYLEKEREKEISDDEAEEEK
GEKEEEDKDDEEKPKIEDVGSDEEDDSGKDKKKKTKKIK
EKYIDQEELNKTKPIWTRNPDDITQEEYGEFYKSLTNDW
EDHLAVKHFSVEGQLEFRALLFIPRRAPFDLFENKKKKN
NIKLYVRRVFIMDSCDELIPEYLNFIRGVVDSEDLPLNI
SREMLQQSKILKVIRKNIVKKCLELFSELAEDKENYKKF
YEAFSKNLKLGIHEDSTNRRRLSELLRYHTSQSGDEMTS
LSEYVSRMKETQKSIYYITGESKEQVANSAFVERVRKRG
FEVVYMTEPIDEYCVQQLKEFDGKSLVSVTKEGLELPED
EEEKKKMEESKAKFENLCKLMKEILDKKVEKVTISNRLV
SSPCCIVTSTYGWTANMERIMKAQALRDNSTMGYMMAKK
HLEINPDHPIVETLRQKAEADKNDKAVKDLVVLLFETAL
LSSGFSLEDPQTHSNRIYRMIKLGLGIDEDEVAAEEPNA
AVPDEIPPLEGDEDASRMEEVD

Purity :

>85%

Protein Size :

~90 kDa

Conjugate :

No tag

Cellular Localization :

Cytoplasm Melanosome

more info or order :

StressMarq Biosciences product webpage