product summary
Loading...
company name :
StressMarq Biosciences
product type :
antibody
product name :
Ataxin 1 Antibody
catalog :
SMC-455D
quantity :
100 µg
price :
300.00 USD
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
S76-8
reactivity :
human, mouse, rat
application :
western blot, immunohistochemistry, immunocytochemistry, immunoprecipitation
more info or order :
product information
Catalog No :
SMC-455D
Product Name :
Ataxin 1 Antibody
Description :
Mouse Anti-Mouse Ataxin 1 Monoclonal IgG2b
Target :
Ataxin 1
Conjugate :
Unconjugated
2021 List Price :
300.00 USD
Currency :
USD
Research Area(s) :
Neuroscience Neurodegeneration Cell Signaling Epigenetics and Nuclear Signaling
Alternative Name(s) :
Ataxin-1 Antibody, ATX1 Antibody, Atxn1 Antibody, D6S504E Antibody, OTTHUMP00000016065 Antibody, SCA1 Antibody, Spinocerebellar ataxia type 1 protein Antibody
Size :
100 µg
Category :
Antibodies
Product Type :
Monoclonal
Clone Number :
S76-8
Immunogen :
Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical).
Immunogen Species :
Mouse
Accession Number :
NP_001186233.1
Swiss-Prot :
P54254
Applications :
WB IHC ICC/IF IP
Host Species :
Mouse
Isotype :
IgG2b
Species Reactivity Abbreviation :
Hu Ms Rt
Species Reactivity Full Name :
Human Mouse Rat
Antibody Dilution :
WB (1:1000), ICC/IF (1:100); optimal dilutions for assays should be determined by the user.
Purification :
Protein G Purified
Storage Buffer :
PBS pH 7.4, 50% glycerol, 0.1% sodium azide
Concentration :
1 mg/ml
Specificity :
Detects ~85kDa.
Storage Temperature :
-20ºC
Shipping Temperature :
Blue Ice or 4ºC
Cite this Product :
StressMarq Biosciences Cat# SMC-455D, RRID: AB_2701937
Certificate of Analysis :
1 µg/ml of SMC-455 was sufficient for detection of Ataxin-1 in 20 µg of rat brain lysate by colorimetric immunoblot analysis using Goat anti-mouse IgG:HRP as the secondary antibody.
Cellular Localization :
Cytoplasm Nucleus
Scientific Background :
Ataxin-1 is a member of the ATXN1 protein family and contains a single AXH domain. It is a neurodegenerative disorder protein thought to have a role in the metabolism of RNA as it has been shown to localize to the RNA and transcription dependent inclusions within the nucleus. A mutation of Ataxin-1 is the cause of spinocerebellar ataxia type-1 (SCA1), a progressive, neurodegenerative disease that is autosomal dominant and primarily affects the Purjinke cells found in brain stem neuronal populations and the cerebellum. Expression of Ataxin-1 is almost ubiquitous, except in the brain where it is isolated to populations of neurons.
Field of Use :
Not for use in humans. Not for use in diagnostics or therapeutics. For in vitro research use only.
Image Filenames :
SMC-455_Ataxin-1_Antibody_S76-8_ICC-IF_Human_SK-N-BE-Cells-Human-Neuroblastoma-cells_60X_Composite_1.png SMC-455-Ataxin-1-Antibody-S76-8-WB-Monkey-COS-1-cells-transfected-with-Ataxin-1-1.png
more info or order :
company information

StressMarq Biosciences
PO Box 55036 CADBORO BAY
3825 Cadboro Bay Road
Victoria BC V8N 4G0
3825 Cadboro Bay Road
Victoria BC V8N 4G0
info@stressmarq.com
http://www.stressmarq.com1-250-294-9065
headquarters: canada
StressMarq Biosciences Inc. is a bioreagents company producing high-quality antibodies, antibody conjugates, proteins, assay kits, and small molecules for the life sciences.
With over 17,000 products, we offer a wide range of products for scientists in cancer, neuroscience, epigenetics, cell signalling, and cellular stress research areas.
Based in Victoria, BC, with a small but dedicated group of scientists, StressMarq provides highly-validated products that are sold with our quality guarantee, and supported by our years of scientific expertise. Our products are available in over 50 countries through our extensive distributor network.
StressMarq draws on scientific excellence from around the globe. We strive to partner with academic or for-profit institutions through licensing agreements to bring cutting-edge research tools to the scientific community.
With over 17,000 products, we offer a wide range of products for scientists in cancer, neuroscience, epigenetics, cell signalling, and cellular stress research areas.
Based in Victoria, BC, with a small but dedicated group of scientists, StressMarq provides highly-validated products that are sold with our quality guarantee, and supported by our years of scientific expertise. Our products are available in over 50 countries through our extensive distributor network.
StressMarq draws on scientific excellence from around the globe. We strive to partner with academic or for-profit institutions through licensing agreements to bring cutting-edge research tools to the scientific community.
related products
browse more products
questions and comments