product summary
Loading...
company name :
StressMarq Biosciences
product type :
antibody
product name :
SUR2A Antibody
catalog :
SMC-431D
quantity :
100 µg
price :
300.00 USD
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
S319A-14
reactivity :
mouse, rat
application :
western blot, immunohistochemistry, immunocytochemistry
more info or order :
product information
Catalog No :
SMC-431D
Product Name :
SUR2A Antibody
Description :
Mouse Anti-Mouse SUR2A Monoclonal IgG2A
Target :
SUR2A
Conjugate :
Unconjugated
2021 List Price :
300.00 USD
Currency :
USD
Research Area(s) :
Neuroscience Cell Markers Neuron Markers Membrane Markers Cell Signaling Cancer
Alternative Name(s) :
ABCC9 Antibody, Sulfonylurea receptor 2 Antibody, CMD10 Antibody, ABC37 Antibody, ATP-binding cassette transporter sub-family C member 9 Antibody, Sulfonylurea receptor 2A Antibody, isoform SUR2A Antibody
Size :
100 µg
Category :
Antibodies
Product Type :
Monoclonal
Clone Number :
S319A-14
Immunogen :
cytoplasmic C-terminus) of mouse SUR2A
(SSIVDAGLVLVFSEGILVECDTGPNLLQHKNGLFSTLV
MTNK,
Fusion protein amino acids 1505-1546
(SSIVDAGLVLVFSEGILVECDTGPNLLQHKNGLFSTLV
MTNK,
Fusion protein amino acids 1505-1546
Immunogen Species :
Mouse
Accession Number :
NP_001038185.1
Swiss-Prot :
P70170
Applications :
WB IHC ICC/IF
Host Species :
Mouse
Isotype :
IgG2A
Species Reactivity Abbreviation :
Ms Rt
Species Reactivity Full Name :
Mouse Rat
Antibody Dilution :
WB (1:1000); optimal dilutions for assays should be determined by the user.
Purification :
Protein G Purified
Storage Buffer :
PBS pH7.4, 50% glycerol, 0.1% sodium azide
Concentration :
1 mg/ml
Specificity :
Detects ~120kDa. Does not cross-react with SUR2B.
Storage Temperature :
-20ºC
Shipping Temperature :
Blue Ice or 4ºC
Cite this Product :
StressMarq Biosciences Cat# SMC-431D, RRID: AB_2701505
Certificate of Analysis :
1 µg/ml of SMC-431 was sufficient for detection of SUR2A in 20 µg of mouse brain membrane lysate and assayed by colorimetric immunoblot analysis using goat anti-mouse IgG:HRP as the secondary antibody.
Cellular Localization :
Membrane
Scientific Background :
Sulfonylurea receptors (SUR) are membrane proteins which are the molecular targets of the sulfonylurea class of anti-diabetic drugs whose mechanism of action is to promote insulin release from pancreatic beta cells. More specifically, SUR proteins are subunits of the inward-rectifier potassium ion channels Kir6.x (6.1 and 6.2) (1). The association of four Kir6.x and four SUR subunits form an ion conducting channel commonly referred to as the KATP channel. The primary function of the sulfonylurea receptor is to sense intracellular levels of the nucleotides ATP and ADP and in response facilitate the open or closing its associated Kir6.x potassium channel. Hence the KATP channel monitors the energy balance within the cell (2).
References :
1. Campbell J.D., Sansom M.S., Ashcroft F.M. (2003) EMBO Resp. 4(11): 1038-1042.
2. Nichols C.G. (2006) Nature. 440 (7083): 470-476.
Field of Use :
Not for use in humans. Not for use in diagnostics or therapeutics. For in vitro research use only.
Image Filenames :
SMC-431-SUR2A-Antibody-S319A-14-ICC-IF-Human-Neuroblastoma-cell-line-SK-N-BE-60X-Composite-1.png SMC-431_SUR2A_Antibody_S319A-14_WB_Rat_Brain-Membrane_1.png
more info or order :
company information

StressMarq Biosciences
PO Box 55036 CADBORO BAY
3825 Cadboro Bay Road
Victoria BC V8N 4G0
3825 Cadboro Bay Road
Victoria BC V8N 4G0
info@stressmarq.com
http://www.stressmarq.com1-250-294-9065
headquarters: canada
StressMarq Biosciences Inc. is a bioreagents company producing high-quality antibodies, antibody conjugates, proteins, assay kits, and small molecules for the life sciences.
With over 17,000 products, we offer a wide range of products for scientists in cancer, neuroscience, epigenetics, cell signalling, and cellular stress research areas.
Based in Victoria, BC, with a small but dedicated group of scientists, StressMarq provides highly-validated products that are sold with our quality guarantee, and supported by our years of scientific expertise. Our products are available in over 50 countries through our extensive distributor network.
StressMarq draws on scientific excellence from around the globe. We strive to partner with academic or for-profit institutions through licensing agreements to bring cutting-edge research tools to the scientific community.
With over 17,000 products, we offer a wide range of products for scientists in cancer, neuroscience, epigenetics, cell signalling, and cellular stress research areas.
Based in Victoria, BC, with a small but dedicated group of scientists, StressMarq provides highly-validated products that are sold with our quality guarantee, and supported by our years of scientific expertise. Our products are available in over 50 countries through our extensive distributor network.
StressMarq draws on scientific excellence from around the globe. We strive to partner with academic or for-profit institutions through licensing agreements to bring cutting-edge research tools to the scientific community.
browse more products
questions and comments
