This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
MilliporeSigma
other brands :
FLUKA, Sigma-Aldrich, Roche Applied Science
product type :
antibody
product name :
Anti-HDX antibody produced in rabbit
catalog :
SAB2104591
clonality :
polyclonal
host :
rabbit
conjugate :
nonconjugated
reactivity :
human, dog, chicken
application :
western blot
product information
cat no :
SAB2104591
brand :
SIGMA
name :
Anti-HDX antibody produced in rabbit
prod type :
Chemical
name suffix :
~1 mg/mL, affinity isolated antibody, lyophilized powder
storage :
-20C
storage temp :
-20C
physical form :
Antibody is lyophilized from PBS buffer with 2% sucrose.
ncbi accession no :
NM_144657
syns :
Anti-CXorf43; Anti-D030011N01Rik; Anti-FLJ30678; Anti-MGC126769; Anti-MGC126771
form :
lyophilized powder
antibody form :
affinity isolated antibody
application(s) :
western blot: suitable
species reactivity :
human, chicken, canine
concentration :
~1 mg/mL
immunogen :
Peptide region of the protein sequence according to NP_653258.
immunogen sequence :
MKADDKEQQQALLSDLPPELEEMDFNHASLEPDDTSFSV
SSLSEKNVSES
SSLSEKNVSES
mol wt :
antigen mol wt ~45 kDa
company information

MilliporeSigma
questions and comments
