Anti-UBAC2 antibody produced in rabbit | MilliporeSigma SAB2103837 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

MilliporeSigma

other brands :

FLUKA, Sigma-Aldrich, Roche Applied Science

product type :

antibody

product name :

Anti-UBAC2 antibody produced in rabbit

catalog :

SAB2103837

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, bovine

application :

western blot

citations: 1

Published Application/Species/Sample/Dilution	Reference
western blot; mouse; loading ...; fig 3f	Llambi F, Wang Y, Victor B, Yang M, Schneider D, Gingras S, et al. BOK Is a Non-canonical BCL-2 Family Effector of Apoptosis Regulated by ER-Associated Degradation. Cell. 2016;165:421-33 pubmed publisher

product information

cat no :

SAB2103837

brand :

SIGMA

name :

Anti-UBAC2 antibody produced in rabbit

prod type :

Chemical

name suffix :

~1 mg/mL, affinity isolated antibody, lyophilized powder

storage :

-20C

storage temp :

-20C

physical form :

Antibody is lyophilized from PBS buffer with 2% sucrose.

ncbi accession no :

NM_177967

syns :

Anti-FLJ26351; Anti-FLJ30001; Anti-FLJ30548; Anti-FLJ42413; Anti-MGC90487

form :

lyophilized powder

antibody form :

affinity isolated antibody

application(s) :

western blot: suitable

species reactivity :

bovine, human, mouse

concentration :

~1 mg/mL

immunogen :

Peptide region of the protein sequence according to NP_808882.

immunogen sequence :

YCSIPRVQVAQILGPLSITNKTLIYILGLQLFTSGSYIW
IVAISGLMSGL

features and benefits :

Antibody BioguaranteeEvaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.

mol wt :

antigen mol wt ~40 kDa