This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
MilliporeSigma
other brands :
FLUKA, Sigma-Aldrich, Roche Applied Science
product type :
antibody
product name :
Anti-UBE4A antibody produced in rabbit
catalog :
SAB2102630
clonality :
polyclonal
host :
rabbit
conjugate :
nonconjugated
reactivity :
human, mouse, rat, dog, chicken, cow
application :
western blot
product information
cat no :
SAB2102630
brand :
SIGMA
name :
Anti-UBE4A antibody produced in rabbit
prod type :
Chemical
name suffix :
affinity isolated antibody, lyophilized powder
storage :
-20C
storage temp :
-20C
physical form :
Lyophilized from PBS buffer with 2% sucrose
syns :
Anti-E4; Anti-KIAA0126; Anti-MGC133315; Anti-UBOX2; Anti-Ubiquitination factor E4A (UFD2 homolog, yeast)
form :
lyophilized powder
antibody form :
affinity isolated antibody
application(s) :
western blot: suitable
species reactivity :
canine, chicken, bovine, human, mouse, rat,
immunogen :
Peptide region of the protein sequence according to NP_004779.
immunogen sequence :
QYAPQLAEALIKVFVDIEFTGDPHQFEQKFNYRRPMYPI
LRYMWGTDTYR
LRYMWGTDTYR
company information

MilliporeSigma
questions and comments
