This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
MilliporeSigma
other brands :
FLUKA, Sigma-Aldrich, Roche Applied Science
product type :
antibody
product name :
Anti-UBE3B antibody produced in rabbit
catalog :
SAB2102629
clonality :
polyclonal
host :
rabbit
conjugate :
nonconjugated
reactivity :
human, mouse, rat, dog, chicken, cow, zebrafish
application :
western blot
product information
cat no :
SAB2102629
brand :
SIGMA
name :
Anti-UBE3B antibody produced in rabbit
prod type :
Chemical
name suffix :
affinity isolated antibody, lyophilized powder
storage :
-20C
storage temp :
-20C
physical form :
Lyophilized from PBS buffer with 2% sucrose
syns :
Anti-DKFZp586K2123; Anti-DKFZp686A1051; Anti-FLJ45294; Anti-MGC131858; Anti-Ubiquitin protein ligase E3B
form :
lyophilized powder
antibody form :
affinity isolated antibody
application(s) :
western blot: suitable
species reactivity :
canine, human, mouse, rat, bovine, zebrafish, chicken,
immunogen :
Peptide region of the protein sequence according to NP_569733.
immunogen sequence :
VDEAGIDQDGVFKEFLEEIIKRVFDPALNLFKTTSGDER
LYPSPTSYIHE
LYPSPTSYIHE
company information

MilliporeSigma
questions and comments
