This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
MilliporeSigma
other brands :
FLUKA, Sigma-Aldrich, Roche Applied Science
product type :
antibody
product name :
Anti-TBCB antibody produced in rabbit
catalog :
SAB2102376
clonality :
polyclonal
host :
rabbit
conjugate :
nonconjugated
reactivity :
human, mouse, dog, cow, zebrafish
application :
western blot
product information
cat no :
SAB2102376
brand :
SIGMA
name :
Anti-TBCB antibody produced in rabbit
prod type :
Chemical
name suffix :
affinity isolated antibody, lyophilized powder
storage :
-20C
storage temp :
-20C
physical form :
Lyophilized from PBS buffer with 2% sucrose
syns :
Anti-CG22; Anti-CKAP1; Anti-CKAPI; Anti-MGC14625; Anti-Tubulin folding cofactor B
form :
lyophilized powder
antibody form :
affinity isolated antibody
application(s) :
western blot: suitable
species reactivity :
pig, human, mouse, rat, canine, zebrafish, bovine,
immunogen :
Peptide region of the protein sequence according to NP_001272.
immunogen sequence :
YDEPLGKNDGSVNGKRYFECQAKYGAFVKPAVVTVGDFP
EEDYGLDEI
EEDYGLDEI
company information

MilliporeSigma
questions and comments
