Anti-RPN1 antibody produced in rabbit | MilliporeSigma SAB2102053 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

MilliporeSigma

other brands :

FLUKA, Sigma-Aldrich, Roche Applied Science

product type :

antibody

product name :

Anti-RPN1 antibody produced in rabbit

catalog :

SAB2102053

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, rat, dogs, chicken, bovine, zebrafish

application :

western blot

citations: 1

Published Application/Species/Sample/Dilution	Reference
western blot; human; loading ...; fig 7b	Massarweh A, Bosco M, Iatmanen Harbi S, Tessier C, Amana L, Busca P, et al. Brefeldin A promotes the appearance of oligosaccharyl phosphates derived from Glc3Man9GlcNAc2-PP-dolichol within the endomembrane system of HepG2 cells. J Lipid Res. 2016;57:1477-91 pubmed publisher

product information

cat no :

SAB2102053

brand :

SIGMA

name :

Anti-RPN1 antibody produced in rabbit

prod type :

Chemical

name suffix :

affinity isolated antibody, lyophilized powder

storage :

-20C

storage temp :

-20C

physical form :

Lyophilized from PBS buffer with 2% sucrose

syns :

Anti-DKFZp686B16177; Anti-OST1; Anti-RBPH1; Anti-Ribophorin I

form :

lyophilized powder

antibody form :

affinity isolated antibody

application(s) :

western blot: suitable

species reactivity :

chicken, pig, canine, human, mouse, rat, bovine, zebrafish

immunogen :

Peptide region of the protein sequence according to NP_002941.

immunogen sequence :

AAEARMKVACITEQVLTLVNKRIGLYRHFDETVNRYKQS
RDISTLNSGKK

features and benefits :

Antibody BioguaranteeEvaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.