This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
MilliporeSigma
other brands :
FLUKA, Sigma-Aldrich, Roche Applied Science
product type :
antibody
product name :
Anti-KIAA1706 antibody produced in mouse
catalog :
SAB1408033
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
reactivity :
human
application :
western blot
citations: 1
Published Application/Species/Sample/DilutionReference
  • western blot; human; loading ...; fig 5d
Nelson J, Koenis D, Scheij S, Cook E, Moeton M, Santos A, et al. EEPD1 Is a Novel LXR Target Gene in Macrophages Which Regulates ABCA1 Abundance and Cholesterol Efflux. Arterioscler Thromb Vasc Biol. 2017;37:423-432 pubmed publisher
product information
cat no :
SAB1408033
brand :
SIGMA
name :
Anti-KIAA1706 antibody produced in mouse
prod type :
Chemical
name suffix :
purified immunoglobulin, buffered aqueous solution
storage :
-20C
storage temp :
-20C
physical form :
Clear, colorless solution in phosphate buffered saline, pH 7.2
shipped in :
dry ice
general description :
Mouse polyclonal antibody raised against a full-length human KIAA1706 protein.
ncbi accession no :
BC065518
form :
buffered aqueous solution
antibody form :
purified immunoglobulin
application(s) :
western blot: suitable
species reactivity :
human
concentration :
~0.5 mg/mL
immunogen :
KIAA1706 (AAH65518.1, 1 a.a. ~ 569 a.a) full-length human protein.
immunogen sequence :
MGSTLGCHRSIPRDPSDLSHSRKFSAACNFSNILVNQER
LNINTATEEELMTLPGVTRAVARSIVEYREYIGGFKKVE
DLALVSGVGATKLEQVKFEICVSSKGSSAQHSPSSLRRD
LLAEQQPHHLATAVPLTPRVNINTATPAQLMSVRGLSEK
MALSIVDFRREHGPFRSVEDLVRMDGINAAFLDRIRHQV
FAERSRPPSTHTNGGLTFTAKPHPSPTSLSLQSEDLDLP
PGGPTQIISTRPSVEAFGGTRDGRPVLRLATWNLQGCSV
EKANNPGVREVVCMTLLENSIKLLAVQELLDREALEKFC
TELNQPTLPNIRKWKGPRGCWKAVVAEKPSNQLQKGAGY
AGFLWDAAAGMELRDAGSQESSPSNGHGKLAGPSPYLGR
FKVGSHDLTLVNLHLAALTLLGSENPSKNHSDGHRLASF
AQTLQETLKGEKDVIILGDFGQGPDSNDYDILRKEKFHH
LIPAHTFTNISTKNPQGSKSLDNIWISKSLKKVFTGHWA
VVREGLTNPWIPDNWSWGGVASEHCPVLAEFYTEKDWSK
KDAPRNGSGVALERSEANIKHER
features and benefits :
Antibody BioguaranteeEvaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.
mol wt :
antigen mol wt ~62.4 kDa
company information
MilliporeSigma
PO Box 14508
St. Louis, MO 63178
https://www.sigmaaldrich.com
1-800-325-3010
headquarters: USA