Anti-CMC1 antibody produced in rabbit | MilliporeSigma HPA043333 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

MilliporeSigma

other brands :

FLUKA, Sigma-Aldrich, Roche Applied Science

product type :

antibody

product name :

Anti-CMC1 antibody produced in rabbit

catalog :

HPA043333

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human

application :

western blot, immunohistochemistry, western blot knockout validation

citations: 2

Published Application/Species/Sample/Dilution	Reference
western blot knockout validation; human; loading ...; fig 4e	Bourens M, Barrientos A. A CMC1-knockout reveals translation-independent control of human mitochondrial complex IV biogenesis. EMBO Rep. 2017;18:477-494 pubmed publisher
western blot; human; fig 2a	Maiti P, Kim H, Tu Y, Barrientos A. Human GTPBP10 is required for mitoribosome maturation. Nucleic Acids Res. 2018;46:11423-11437 pubmed publisher

product information

cat no :

HPA043333

brand :

SIGMA

name :

Anti-CMC1 antibody produced in rabbit

prod type :

Chemical

name suffix :

Prestige Antibodies(R) Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

storage :

-20C

storage temp :

-20C

physical form :

Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

legal information :

Prestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC

shipped in :

wet ice

syns :

Anti-C3orf68; Anti-Cox assembly mitochondrial protein homolog (S. cerevisiae); Anti-Mgc61571

form :

buffered aqueous glycerol solution

antibody form :

affinity isolated antibody

application(s) :

protein array: suitable; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable

species reactivity :

human

immunogen :

COX assembly mitochondrial protein homolog (S. cerevisiae) recombinant protein epitope signature tag (PrEST)

immunogen sequence :

RCSEQVQDFTKCCKNSGVLMVVKCRKENSALKECLTAYY
NDPAFYEECKMEYLKEREEFRKTGIPTKKRLQKLPTSM

grade :

Prestige Antibodies(R) Powered by Atlas Antibodies