Anti-HAND1 antibody produced in rabbit | MilliporeSigma HPA040925 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

MilliporeSigma

other brands :

FLUKA, Sigma-Aldrich, Roche Applied Science

product type :

antibody

product name :

Anti-HAND1 antibody produced in rabbit

catalog :

HPA040925

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human

application :

immunohistochemistry, immunocytochemistry

citations: 1

Published Application/Species/Sample/Dilution	Reference
immunocytochemistry; human; loading ...; fig s4a	Tchieu J, Zimmer B, Fattahi F, Amin S, Zeltner N, Chen S, et al. A Modular Platform for Differentiation of Human PSCs into All Major Ectodermal Lineages. Cell Stem Cell. 2017;21:399-410.e7 pubmed publisher

product information

cat no :

HPA040925

brand :

SIGMA

name :

Anti-HAND1 antibody produced in rabbit

prod type :

Chemical

name suffix :

Prestige Antibodies(R) Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

storage :

-20C

storage temp :

-20C

physical form :

Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

legal information :

Prestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC

shipped in :

wet ice

syns :

Anti-Bhlha27; Anti-Ehand; Anti-Heart and neural crest derivatives expressed 1; Anti-Hxt; Anti-Thing1

form :

buffered aqueous glycerol solution

antibody form :

affinity isolated antibody

application(s) :

protein array: suitable; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable

species reactivity :

human

immunogen :

heart and neural crest derivatives expressed 1 recombinant protein epitope signature tag (PrEST)

immunogen sequence :

LMDVLAKDAQSGDPEAFKAELKKADGGRESKRKRELQQH
EGFPPALGPVEKRIKGRTG

grade :

Prestige Antibodies(R) Powered by Atlas Antibodies

features and benefits :

Antibody BioguaranteeEvaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.