Anti-C20orf72 antibody produced in rabbit | MilliporeSigma HPA040913 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

MilliporeSigma

other brands :

FLUKA, Sigma-Aldrich, Roche Applied Science

product type :

antibody

product name :

Anti-C20orf72 antibody produced in rabbit

catalog :

HPA040913

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human

application :

western blot, immunohistochemistry

citations: 2

Published Application/Species/Sample/Dilution	Reference
western blot; human; loading ...; fig s6a	Phillips A, Millet A, Tigano M, Dubois S, Crimmins H, Babin L, et al. Single-Molecule Analysis of mtDNA Replication Uncovers the Basis of the Common Deletion. Mol Cell. 2017;65:527-538.e6 pubmed publisher
	Peeva V, Blei D, Trombly G, Corsi S, Szukszto M, Rebelo Guiomar P, et al. Linear mitochondrial DNA is rapidly degraded by components of the replication machinery. Nat Commun. 2018;9:1727 pubmed publisher

product information

cat no :

HPA040913

brand :

SIGMA

name :

Anti-C20orf72 antibody produced in rabbit

prod type :

Chemical

name suffix :

Prestige Antibodies(R) Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

storage :

-20C

storage temp :

-20C

physical form :

Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

legal information :

Prestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC

shipped in :

wet ice

syns :

Anti-Chromosome 20 open reading frame 72; Anti-bA504H3.4

form :

buffered aqueous glycerol solution

antibody form :

affinity isolated antibody

application(s) :

immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; protein array: suitable

species reactivity :

human

immunogen :

chromosome 20 open reading frame 72 recombinant protein epitope signature tag (PrEST)

immunogen sequence :

NLVQSVLSSRGVAQTPGSVEEDALLCGPVSKHKLPNQGE
DRRVPQNWFPIFNPERSDKPNASDPSVPLKIPLQRNVIP
SVTRVL

grade :

Prestige Antibodies(R) Powered by Atlas Antibodies

features and benefits :

Antibody BioguaranteeEvaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.