Anti-HPD antibody produced in rabbit | MilliporeSigma HPA038322 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

MilliporeSigma

other brands :

FLUKA, Sigma-Aldrich, Roche Applied Science

product type :

antibody

product name :

Anti-HPD antibody produced in rabbit

catalog :

HPA038322

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse

application :

western blot, immunohistochemistry, western blot knockout validation

citations: 2

Published Application/Species/Sample/Dilution	Reference
western blot knockout validation; mouse; 1:500; loading ...; fig 1c	Pankowicz F, Barzi M, Kim K, Legras X, Martins C, Wooton Kee C, et al. Rapid Disruption of Genes Specifically in Livers of Mice Using Multiplex CRISPR/Cas9 Editing. Gastroenterology. 2018;155:1967-1970.e6 pubmed publisher
western blot knockout validation; mouse; 1:500; fig 1	Pankowicz F, Barzi M, Legras X, Hubert L, Mi T, Tomolonis J, et al. Reprogramming metabolic pathways in vivo with CRISPR/Cas9 genome editing to treat hereditary tyrosinaemia. Nat Commun. 2016;7:12642 pubmed publisher

product information

cat no :

HPA038322

brand :

SIGMA

name :

Anti-HPD antibody produced in rabbit

prod type :

Chemical

name suffix :

Prestige Antibodies(R) Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

storage :

-20C

storage temp :

-20C

physical form :

Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

legal information :

Prestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC

shipped in :

wet ice

syns :

Anti-4-HPPD; Anti-4-hydroxyphenylpyruvate dioxygenase; Anti-4HPPD; Anti-GLOD3; Anti-PPD

form :

buffered aqueous glycerol solution

antibody form :

affinity isolated antibody

application(s) :

protein array: suitable; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; western blot: suitable

species reactivity :

human

immunogen :

4-hydroxyphenylpyruvate dioxygenase recombinant protein epitope signature tag (PrEST)

immunogen sequence :

REPWVEQDKFGKVKFAVLQTYGDTTHTLVEKMNYIGQFL
PGYEAPAFMDPLLPKLPKCSLEMIDHIVGNQP

grade :

Prestige Antibodies(R) Powered by Atlas Antibodies

features and benefits :

Antibody BioguaranteeEvaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.