This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
MilliporeSigma
other brands :
FLUKA, Sigma-Aldrich, Roche Applied Science
product type :
antibody
product name :
Anti-SHANK1 antibody produced in rabbit
catalog :
HPA032129
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse
application :
western blot, immunohistochemistry
citations: 1
product information
cat no :
HPA032129
brand :
SIGMA
name :
Anti-SHANK1 antibody produced in rabbit
prod type :
Chemical
name suffix :
Prestige Antibodies(R) Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
storage :
-20C
storage temp :
-20C
physical form :
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.
legal information :
Prestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
shipped in :
wet ice
syns :
Anti-SH3 and multiple ankyrin repeat domains 1; Anti-SPANK-1; Anti-SSTRIP; Anti-synamon
mdl no :
MFCD03455962
form :
buffered aqueous glycerol solution
antibody form :
affinity isolated antibody
application(s) :
protein array: suitable; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
species reactivity :
human
immunogen :
SH3 and multiple ankyrin repeat domains 1 recombinant protein epitope signature tag (PrEST)
immunogen sequence :
TVKASIISELSSKLQQFGGSSAAGGALPWARGGSGGGGD
SHHGGASYVPERTSSLQRQRLSDDSQSSLLSKPVSSLFQ
NWPKPPLP
SHHGGASYVPERTSSLQRQRLSDDSQSSLLSKPVSSLFQ
NWPKPPLP
grade :
Prestige Antibodies(R) Powered by Atlas Antibodies
features and benefits :
Antibody BioguaranteeEvaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.
company information

MilliporeSigma
questions and comments
