Anti-YKT6 antibody produced in rabbit | MilliporeSigma HPA030817 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

MilliporeSigma

other brands :

FLUKA, Sigma-Aldrich, Roche Applied Science

product type :

antibody

product name :

Anti-YKT6 antibody produced in rabbit

catalog :

HPA030817

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse

application :

western blot, immunohistochemistry

citations: 1

Published Application/Species/Sample/Dilution	Reference
western blot; mouse; fig 8i	Xu D, Li Y, Wu L, Li Y, Zhao D, Yu J, et al. Rab18 promotes lipid droplet (LD) growth by tethering the ER to LDs through SNARE and NRZ interactions. J Cell Biol. 2018;217:975-995 pubmed publisher

product information

cat no :

HPA030817

brand :

SIGMA

name :

Anti-YKT6 antibody produced in rabbit

prod type :

Chemical

name suffix :

Prestige Antibodies(R) Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution, ab1

storage :

-20C

storage temp :

-20C

physical form :

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

legal information :

Prestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC

shipped in :

wet ice

syns :

Anti-YKT6 v-SNARE homolog (S. cerevisiae)

form :

buffered aqueous glycerol solution

antibody form :

affinity isolated antibody

application(s) :

protein array: suitable; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; western blot: suitable

species reactivity :

human

immunogen :

YKT6 v-SNARE homolog (S. cerevisiae) recombinant protein epitope signature tag (PrEST)

immunogen sequence :

LCHVYVRNDSLAGVVIADNEYPSRVAFTLLEKVLDEFSK
QVDRIDWPVGSPATIHYPALDGHLSRYQ

grade :

Prestige Antibodies(R) Powered by Atlas Antibodies

features and benefits :

Antibody BioguaranteeEvaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.