Anti-MRPS10 antibody produced in rabbit | MilliporeSigma HPA029134 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

MilliporeSigma

other brands :

FLUKA, Sigma-Aldrich, Roche Applied Science

product type :

antibody

product name :

Anti-MRPS10 antibody produced in rabbit

catalog :

HPA029134

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human

application :

western blot, immunohistochemistry

citations: 1

Published Application/Species/Sample/Dilution	Reference
western blot; human; fig 4	Nouws J, Goswami A, Bestwick M, McCann B, Surovtseva Y, Shadel G. Mitochondrial Ribosomal Protein L12 Is Required for POLRMT Stability and Exists as Two Forms Generated by Alternative Proteolysis during Import. J Biol Chem. 2016;291:989-97 pubmed publisher

product information

cat no :

HPA029134

brand :

SIGMA

name :

Anti-MRPS10 antibody produced in rabbit

prod type :

Chemical

name suffix :

Prestige Antibodies(R) Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution, ab2

storage :

-20C

storage temp :

-20C

physical form :

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

legal information :

Prestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC

shipped in :

wet ice

syns :

Anti-FLJ10567; Anti-mitochondrial ribosomal protein S10

form :

buffered aqueous glycerol solution

antibody form :

affinity isolated antibody

application(s) :

protein array: suitable; western blot: suitable; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable

species reactivity :

human

immunogen :

mitochondrial ribosomal protein S10 recombinant protein epitope signature tag (PrEST)

immunogen sequence :

YEMRTLYRCLELEHLTGSTADVYLEYIQRNLPEGVAMEV
TKTQLEQLPEHIKEPIWETLSEE

grade :

Prestige Antibodies(R) Powered by Atlas Antibodies

features and benefits :

Antibody BioguaranteeEvaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.