Anti-CGN antibody produced in rabbit | MilliporeSigma HPA027586 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

MilliporeSigma

other brands :

FLUKA, Sigma-Aldrich, Roche Applied Science

product type :

antibody

product name :

Anti-CGN antibody produced in rabbit

catalog :

HPA027586

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse

application :

western blot, immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section

citations: 1

Published Application/Species/Sample/Dilution	Reference
immunohistochemistry - paraffin section; mouse; loading ...; fig 5d western blot; mouse; loading ...; fig 5b immunohistochemistry - paraffin section; human; loading ...; fig 1a immunocytochemistry; human; loading ...; fig 2a western blot; human; loading ...; fig 2c	Schossleitner K, Rauscher S, GrÃ¶ger M, Friedl H, Finsterwalder R, Habertheuer A, et al. Evidence That Cingulin Regulates Endothelial Barrier Function In Vitro and In Vivo. Arterioscler Thromb Vasc Biol. 2016;36:647-54 pubmed publisher

product information

cat no :

HPA027586

brand :

SIGMA

name :

Anti-CGN antibody produced in rabbit

prod type :

Chemical

name suffix :

Prestige Antibodies(R) Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution, ab1

storage :

-20C

storage temp :

-20C

physical form :

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

legal information :

Prestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC

shipped in :

wet ice

syns :

Anti-KIAA1319; Anti-cingulin

form :

buffered aqueous glycerol solution

antibody form :

affinity isolated antibody

application(s) :

western blot: suitable; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; protein array: suitable

species reactivity :

human

immunogen :

cingulin recombinant protein epitope signature tag (PrEST)

immunogen sequence :

PPGSVDHMKATIYGILREGSSESETSVRRKVSLVLEKMQ
PLVMVSSGSTKAVAGQGELTRKVEELQRKLDEEVKKRQK
LEPSQVGLERQLEEKTEECSRLQELLER

grade :

Prestige Antibodies(R) Powered by Atlas Antibodies

features and benefits :

Antibody BioguaranteeEvaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.