Anti-SSX2IP antibody produced in rabbit | MilliporeSigma HPA027306 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

MilliporeSigma

other brands :

FLUKA, Sigma-Aldrich, Roche Applied Science

product type :

antibody

product name :

Anti-SSX2IP antibody produced in rabbit

catalog :

HPA027306

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human

application :

western blot, immunohistochemistry, immunocytochemistry

citations: 2

Published Application/Species/Sample/Dilution	Reference
immunohistochemistry; human; 1:150; loading ...; fig s2b	Mönnich M, Borgeskov L, Breslin L, Jakobsen L, Rogowski M, Doğanlı C, et al. CEP128 Localizes to the Subdistal Appendages of the Mother Centriole and Regulates TGF-β/BMP Signaling at the Primary Cilium. Cell Rep. 2018;22:2584-2592 pubmed publisher
immunocytochemistry; human; 1:150 western blot; human; 1:150; fig 2	Hori A, Barnouin K, Snijders A, Toda T. A non-canonical function of Plk4 in centriolar satellite integrity and ciliogenesis through PCM1 phosphorylation. EMBO Rep. 2016;17:326-37 pubmed publisher

product information

cat no :

HPA027306

brand :

SIGMA

name :

Anti-SSX2IP antibody produced in rabbit

prod type :

Chemical

name suffix :

Prestige Antibodies(R) Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

storage :

-20C

storage temp :

-20C

physical form :

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

legal information :

Prestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC

shipped in :

wet ice

syns :

Anti-ADIP; Anti-Afadin DIL domain-interacting protein; Anti-Afadin- and alpha-actinin-binding protein; Anti-SSX2-interacting protein

form :

buffered aqueous glycerol solution

antibody form :

affinity isolated antibody

application(s) :

western blot: suitable; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; protein array: suitable

species reactivity :

human

immunogen :

Afadin- and alpha-actinin-binding protein recombinant protein epitope signature tag (PrEST)

immunogen sequence :

DEMYKILLNDYEYRQKQILMENAELKKVLQQMKKEMISL
LSPQKKKPRERVDDSTGTVISDVEEDAGELSRESMWDLS
CETVREQLTNSIRKQWRILKSHVEKLDNQVSKVHLEGFN
DEDVISRQDHEQETE

grade :

Prestige Antibodies(R) Powered by Atlas Antibodies

features and benefits :

Antibody BioguaranteeEvaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.