Anti-CAMSAP1L1 antibody produced in rabbit | MilliporeSigma HPA027302 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

MilliporeSigma

other brands :

FLUKA, Sigma-Aldrich, Roche Applied Science

product type :

antibody

product name :

Anti-CAMSAP1L1 antibody produced in rabbit

catalog :

HPA027302

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human

application :

western blot, immunohistochemistry, immunocytochemistry

citations: 2

Published Application/Species/Sample/Dilution	Reference
immunocytochemistry; human; loading ...; fig 1a	Wei J, Xu H, Meng W. Noncentrosomal microtubules regulate autophagosome transport through CAMSAP2-EB1 cross-talk. FEBS Lett. 2017;591:2379-2393 pubmed publisher
immunocytochemistry; human; 1:250; loading ...; fig s1b	Dong C, Xu H, Zhang R, Tanaka N, Takeichi M, Meng W. CAMSAP3 accumulates in the pericentrosomal area and accompanies microtubule release from the centrosome via katanin. J Cell Sci. 2017;130:1709-1715 pubmed publisher

product information

cat no :

HPA027302

brand :

SIGMA

name :

Anti-CAMSAP1L1 antibody produced in rabbit

prod type :

Chemical

name suffix :

Prestige Antibodies(R) Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution, Ab3

storage :

-20C

storage temp :

-20C

physical form :

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

legal information :

Prestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC

shipped in :

wet ice

syns :

Anti-Calmodulin-regulated spectrin-associated protein 1-like protein 1

form :

buffered aqueous glycerol solution

antibody form :

affinity isolated antibody

application(s) :

protein array: suitable; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; western blot: suitable

species reactivity :

human

immunogen :

Calmodulin-regulated spectrin-associated protein 1-like protein 1 recombinant protein epitope signature tag (PrEST)

immunogen sequence :

KLVTERDLHKKPIQMSAHLAMIDTLMMAYTVEMVSIEKV
IACAQQYSAFFQATDLPYDIEDAVMYWINKVNEHLKDIM
EQEQKLKEHHTVEAPGG

grade :

Prestige Antibodies(R) Powered by Atlas Antibodies

features and benefits :

Antibody BioguaranteeEvaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.