Anti-EIF3E antibody produced in rabbit | MilliporeSigma HPA023973 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

MilliporeSigma

other brands :

FLUKA, Sigma-Aldrich, Roche Applied Science

product type :

antibody

product name :

Anti-EIF3E antibody produced in rabbit

catalog :

HPA023973

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse

application :

western blot, immunohistochemistry, immunocytochemistry, proximity ligation assay

citations: 1

Published Application/Species/Sample/Dilution	Reference
proximity ligation assay; mouse; loading ...; fig 2f immunocytochemistry; mouse; 1:100; loading ...; fig 2e western blot; mouse; 1:300; loading ...; fig 5a	V kovski P, Gerber M, Kelly J, Pfaender S, Ebert N, Braga Lagache S, et al. Determination of host proteins composing the microenvironment of coronavirus replicase complexes by proximity-labeling. elife. 2019;8: pubmed publisher

product information

cat no :

HPA023973

brand :

SIGMA

name :

Anti-EIF3E antibody produced in rabbit

prod type :

Chemical

name suffix :

Prestige Antibodies(R) Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

storage :

-20C

storage temp :

-20C

physical form :

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

legal information :

Prestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC

shipped in :

wet ice

syns :

Anti-Eukaryotic translation initiation factor 3 subunit 6; Anti-Eukaryotic translation initiation factor 3 subunit E; Anti-Viral integration site protein INT-6 homolog; Anti-eIF-3 p48; Anti-eIF3e

form :

buffered aqueous glycerol solution

antibody form :

affinity isolated antibody

application(s) :

protein array: suitable; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; western blot: suitable; indirect immunofluorescence: suitable

species reactivity :

human

immunogen :

Eukaryotic translation initiation factor 3 subunit E recombinant protein epitope signature tag (PrEST)

immunogen sequence :

ARLFIFETFCRIHQCISINMLADKLNMTPEEAERWIVNL
IRNARLDAKIDSKLGHVVMGNNAVSPYQQVIEKTKSLSF
RSQMLAMNIEKKLNQNSRSEAPNWATQDSGFY

grade :

Prestige Antibodies(R) Powered by Atlas Antibodies

features and benefits :

Antibody BioguaranteeEvaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.