This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
MilliporeSigma
other brands :
FLUKA, Sigma-Aldrich, Roche Applied Science
product type :
antibody
product name :
Anti-ATP6V1C1 antibody produced in rabbit
catalog :
HPA023943
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human
application :
western blot, immunohistochemistry
product information
cat no :
HPA023943
brand :
SIGMA
name :
Anti-ATP6V1C1 antibody produced in rabbit
prod type :
Chemical
name suffix :
Prestige Antibodies(R) Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution, Ab1
storage :
-20C
storage temp :
-20C
physical form :
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
legal information :
Prestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
shipped in :
wet ice
syns :
Anti-V-ATPase subunit C 1; Anti-V-type proton ATPase subunit C 1; Anti-Vacuolar proton pump subunit C 1
form :
buffered aqueous glycerol solution
antibody form :
affinity isolated antibody
application(s) :
western blot: suitable; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; protein array: suitable
species reactivity :
human
immunogen :
V-type proton ATPase subunit C 1 recombinant protein epitope signature tag (PrEST)
immunogen sequence :
NFQAMLLQPNKKTLKKLREVLHELYKHLDSSAAAIIDAP
MDIPGLNLSQQEYYPYVYYKIDC
MDIPGLNLSQQEYYPYVYYKIDC
grade :
Prestige Antibodies(R) Powered by Atlas Antibodies
company information

MilliporeSigma
questions and comments
