This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
MilliporeSigma
other brands :
FLUKA, Sigma-Aldrich, Roche Applied Science
product type :
antibody
product name :
Anti-ESRP1 antibody produced in rabbit
catalog :
HPA023720
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human
application :
western blot, immunohistochemistry
citations: 1
Published Application/Species/Sample/DilutionReference
  • western blot; human; 1:500; loading ...; fig 1A
Hiraga T, Nakamura H. Comparable roles of CD44v8-10 and CD44s in the development of bone metastases in a mouse model. Oncol Lett. 2016;12:2962-2969 pubmed
product information
cat no :
HPA023720
brand :
SIGMA
name :
Anti-ESRP1 antibody produced in rabbit
prod type :
Chemical
name suffix :
Prestige Antibodies(R) Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution, Ab2
storage :
-20C
storage temp :
-20C
physical form :
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
legal information :
Prestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
shipped in :
wet ice
syns :
Anti-RNA-binding motif protein 35A; Anti-RNA-binding protein 35A
form :
buffered aqueous glycerol solution
antibody form :
affinity isolated antibody
application(s) :
immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; indirect immunofluorescence: suitable; western blot: suitable; protein array: suitable
species reactivity :
human
immunogen :
RNA-binding protein 35A recombinant protein epitope signature tag (PrEST)
immunogen sequence :
QLHVRQILHPEASKKNVLLPECFYSFFDLRKEFKKCCPG
SPDIDKLDVATMTEYLNFEKSSSVSRYGASQVEDMGNII
LAMISEPYNHRFSDPERVNYKFES
grade :
Prestige Antibodies(R) Powered by Atlas Antibodies
company information
MilliporeSigma
PO Box 14508
St. Louis, MO 63178
https://www.sigmaaldrich.com
1-800-325-3010
headquarters: USA