Anti-NAA35 antibody produced in rabbit | MilliporeSigma HPA021547 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

MilliporeSigma

other brands :

FLUKA, Sigma-Aldrich, Roche Applied Science

product type :

antibody

product name :

Anti-NAA35 antibody produced in rabbit

catalog :

HPA021547

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human

application :

western blot, immunohistochemistry

citations: 1

Published Application/Species/Sample/Dilution	Reference
western blot; human; loading ...; fig 1b	Van Damme P, Kalvik T, Starheim K, Jonckheere V, Myklebust L, Menschaert G, et al. A Role for Human N-alpha Acetyltransferase 30 (Naa30) in Maintaining Mitochondrial Integrity. Mol Cell Proteomics. 2016;15:3361-3372 pubmed

product information

cat no :

HPA021547

brand :

SIGMA

name :

Anti-NAA35 antibody produced in rabbit

prod type :

Chemical

name suffix :

Prestige Antibodies(R) Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

storage :

-20C

storage temp :

-20C

physical form :

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

legal information :

Prestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC

shipped in :

wet ice

syns :

Anti-Embryonic growth-associated protein homolog; Anti-MAK10; Anti-Protein MAK10 homolog

form :

buffered aqueous glycerol solution

antibody form :

affinity isolated antibody

application(s) :

immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; indirect immunofluorescence: suitable; western blot: suitable; protein array: suitable

species reactivity :

human

immunogen :

Protein MAK10 homolog recombinant protein epitope signature tag (PrEST)

immunogen sequence :

KKVRPLSREITMSQAYQNMCAGMFKTMVAFDMDGKVRKP
KFELDSEQVRYEHRFAPFNSVMTPPPVHYLQFKEMSDLN
KYSPPPQSPELYVAASKHFQQ

grade :

Prestige Antibodies(R) Powered by Atlas Antibodies

features and benefits :

Antibody BioguaranteeEvaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.