Anti-RUVBL1 antibody produced in rabbit | MilliporeSigma HPA019948 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

MilliporeSigma

other brands :

FLUKA, Sigma-Aldrich, Roche Applied Science

product type :

antibody

product name :

Anti-RUVBL1 antibody produced in rabbit

catalog :

HPA019948

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse

application :

western blot, immunohistochemistry

citations: 1

Published Application/Species/Sample/Dilution	Reference
western blot; mouse; loading ...; fig 4a	Da Ros M, Lehtiniemi T, Olotu O, Fischer D, Zhang F, Vihinen H, et al. FYCO1 and autophagy control the integrity of the haploid male germ cell-specific RNP granules. Autophagy. 2017;13:302-321 pubmed publisher

product information

cat no :

HPA019948

brand :

SIGMA

name :

Anti-RUVBL1 antibody produced in rabbit

prod type :

Chemical

name suffix :

Prestige Antibodies(R) Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution, Ab2

storage :

-20C

storage temp :

-20C

physical form :

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

legal information :

Prestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC

shipped in :

wet ice

syns :

Anti-49 kDa TATA box-binding protein-interacting protein; Anti-49 kDa TBP-interacting protein; Anti-ECP-54; Anti-INO80 complex subunit H; Anti-NMP 238; Anti-Pontin 52; Anti-RuvB-like 1; Anti-TAP54-alpha; Anti-TIP49a

form :

buffered aqueous glycerol solution

antibody form :

affinity isolated antibody

application(s) :

western blot: suitable; indirect immunofluorescence: suitable; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; protein array: suitable

species reactivity :

human

immunogen :

RuvB-like 1 recombinant protein epitope signature tag (PrEST)

immunogen sequence :

GPPGTGKTALALAIAQELGSKVPFCPMVGSEVYSTEIKK
TEVLMENFRRAIGLRIKETKEVYEGEVTELTPCETENPM
GG

grade :

Prestige Antibodies(R) Powered by Atlas Antibodies