Anti-MIER1 antibody produced in rabbit | MilliporeSigma HPA019589 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

MilliporeSigma

other brands :

FLUKA, Sigma-Aldrich, Roche Applied Science

product type :

antibody

product name :

Anti-MIER1 antibody produced in rabbit

catalog :

HPA019589

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse

application :

western blot, immunohistochemistry

citations: 1

Published Application/Species/Sample/Dilution	Reference
immunohistochemistry; mouse; fig 5 western blot; mouse; fig 5	Lakisic G, Lebreton A, Pourpre R, Wendling O, Libertini E, Radford E, et al. Role of the BAHD1 Chromatin-Repressive Complex in Placental Development and Regulation of Steroid Metabolism. PLoS Genet. 2016;12:e1005898 pubmed publisher

product information

cat no :

HPA019589

brand :

SIGMA

name :

Anti-MIER1 antibody produced in rabbit

prod type :

Chemical

name suffix :

Prestige Antibodies(R) Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

storage :

-20C

storage temp :

-20C

physical form :

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

legal information :

Prestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC

shipped in :

wet ice

syns :

Anti-Early response 1; Anti-Er1; Anti-Mesoderm induction early response protein 1; Anti-Mi-er1; Anti-hmi-er1

form :

buffered aqueous glycerol solution

antibody form :

affinity isolated antibody

application(s) :

indirect immunofluorescence: suitable; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; protein array: suitable

species reactivity :

human

immunogen :

Mesoderm induction early response protein 1 recombinant protein epitope signature tag (PrEST)

immunogen sequence :

MMEGETNFSSEIEDLAREGDMPIHELLSLYGYGSTVRLP
EEDEEEEEEEEEGEDDEDADNDDNSGCSGENKEENIKDS
SGQEDETQSSNDDPSQSVASQDAQEI

grade :

Prestige Antibodies(R) Powered by Atlas Antibodies