Anti-C10orf118 antibody produced in rabbit | MilliporeSigma HPA018019 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

MilliporeSigma

other brands :

FLUKA, Sigma-Aldrich, Roche Applied Science

product type :

antibody

product name :

Anti-C10orf118 antibody produced in rabbit

catalog :

HPA018019

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse

application :

western blot, immunohistochemistry, immunohistochemistry - frozen section, western blot knockout validation

citations: 3

Published Application/Species/Sample/Dilution	Reference
western blot knockout validation; mouse; 1:1000; fig 1 immunohistochemistry - frozen section; mouse; 1:1000; fig 1 immunohistochemistry; mouse; 1:1000; fig S1	Wang G, Li R, Yang Y, Cai L, Ding S, Xu T, et al. Disruption of the Golgi protein Otg1 gene causes defective hormone secretion and aberrant glucose homeostasis in mice. Cell Biosci. 2016;6:41 pubmed publisher
western blot; human; 1:400; loading ...; fig 5b	Song K, Gras C, Capin G, Gimber N, Lehmann M, Mohd S, et al. A SEPT1-based scaffold is required for Golgi integrity and function. J Cell Sci. 2019;132: pubmed publisher
	Rapino F, Delaunay S, Rambow F, Zhou Z, Tharun L, de Tullio P, et al. Codon-specific translation reprogramming promotes resistance to targeted therapy. Nature. 2018;558:605-609 pubmed publisher

product information

cat no :

HPA018019

brand :

SIGMA

name :

Anti-C10orf118 antibody produced in rabbit

prod type :

Chemical

name suffix :

Ab1, Prestige Antibodies(R) Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

storage :

-20C

storage temp :

-20C

physical form :

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

legal information :

Prestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC

shipped in :

wet ice

syns :

Anti-CTCL tumor antigen HD-CL-01/L14-2; Anti-Uncharacterized protein C10orf118

wgk :

form :

buffered aqueous glycerol solution

antibody form :

affinity isolated antibody

application(s) :

western blot: suitable; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; protein array: suitable

species reactivity :

human

immunogen :

Uncharacterized protein C10orf118 recombinant protein epitope signature tag (PrEST)

immunogen sequence :

LKRTFKEGMDELRTLRTKVKCLEDERLRTEDELSKYKEI
INRQKAEIQNLLDKVKTADQLQEQLQRGKQEIENLKEEV
ESLNSLINDLQKDIEGSRKRESELLLFTERLTSKNAQLQ
SESNSLQSQFDKVSC

grade :

Prestige Antibodies(R) Powered by Atlas Antibodies