Anti-ATP6V0D1 antibody produced in rabbit | MilliporeSigma HPA016938 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

MilliporeSigma

other brands :

FLUKA, Sigma-Aldrich, Roche Applied Science

product type :

antibody

product name :

Anti-ATP6V0D1 antibody produced in rabbit

catalog :

HPA016938

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse

application :

western blot, immunohistochemistry

citations: 1

Published Application/Species/Sample/Dilution	Reference
western blot; mouse; fig 7	Bao Z, Chen R, Zhang P, Lu S, Chen X, Yao Y, et al. A potential target gene for the host-directed therapy of mycobacterial infection in murine macrophages. Int J Mol Med. 2016;38:823-33 pubmed publisher

product information

cat no :

HPA016938

brand :

SIGMA

name :

Anti-ATP6V0D1 antibody produced in rabbit

prod type :

Chemical

name suffix :

Prestige Antibodies(R) Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

storage :

-20C

storage temp :

-20C

physical form :

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

legal information :

Prestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC

shipped in :

wet ice

syns :

Anti-32 kDa accessory protein; Anti-P39; Anti-V-ATPase 40 kDa accessory protein; Anti-V-ATPase AC39 subunit; Anti-V-ATPase subunit d 1; Anti-Vacuolar proton pump subunit d 1

wgk :

form :

buffered aqueous glycerol solution

antibody form :

affinity isolated antibody

application(s) :

protein array: suitable; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable

species reactivity :

human

immunogen :

Vacuolar proton pump subunit d1(V-ATPase subunit d 1) (V-ATPase AC39 subunit) (V-ATPase 40 kDa accessory protein) (P39) (32 kDa accessory protein).

immunogen sequence :

TELSKEDRAKLFPHCGRLYPEGLAQLARADDYEQVKNVA
DYYPEYKLLFEGAGSNPGDKTLEDRFFEHEVKLNKLAFL
NQFHFGVFYAFVKL

grade :

Prestige Antibodies(R) Powered by Atlas Antibodies