Anti-UBXN1 antibody produced in rabbit | MilliporeSigma HPA012669 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

MilliporeSigma

other brands :

FLUKA, Sigma-Aldrich, Roche Applied Science

product type :

antibody

product name :

Anti-UBXN1 antibody produced in rabbit

catalog :

HPA012669

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse

application :

western blot, immunohistochemistry, immunocytochemistry, immunoprecipitation

citations: 1

Published Application/Species/Sample/Dilution	Reference
immunoprecipitation; human; 1:100; loading ...; fig 3c western blot; human; loading ...; fig 3b,3c, 5c, 6a, 6c immunocytochemistry; mouse; 1:400; loading ...; fig 6d	Hu Y, O Boyle K, Auer J, Raju S, You F, Wang P, et al. Multiple UBXN family members inhibit retrovirus and lentivirus production and canonical NFκΒ signaling by stabilizing IκBα. PLoS Pathog. 2017;13:e1006187 pubmed publisher

product information

cat no :

HPA012669

brand :

SIGMA

name :

Anti-UBXN1 antibody produced in rabbit

prod type :

Chemical

name suffix :

Prestige Antibodies(R) Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

storage :

-20C

storage temp :

-20C

physical form :

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

legal information :

Prestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC

shipped in :

wet ice

syns :

Anti-SAPK substrate protein 1; Anti-UBA/UBX 33.3 kDa protein; Anti-UBX domain-containing protein 1

form :

buffered aqueous glycerol solution

antibody form :

affinity isolated antibody

application(s) :

protein array: suitable; western blot: suitable; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable

species reactivity :

human

immunogen :

UBX domain-containing protein 1 recombinant protein epitope signature tag (PrEST)

immunogen sequence :

MAELTALESLIEMGFPRGRAEKALALTGNQGIEAAMDWL
MEHEDDPDVDEPLETPLGHILGREPTSSEQGGLEGSGSA
AGEGKPALSEEERQEQTKRMLELVAQKQREREEREEREA
LERERQRRRQGQELSAARQRLQEDEMRRAAEER

grade :

Prestige Antibodies(R) Powered by Atlas Antibodies

features and benefits :

Antibody BioguaranteeEvaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.