This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
MilliporeSigma
other brands :
FLUKA, Sigma-Aldrich, Roche Applied Science
product type :
antibody
product name :
Anti-AJAP1 antibody produced in rabbit
catalog :
HPA012157
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse
application :
immunohistochemistry
citations: 1
Published Application/Species/Sample/DilutionReference
  • immunohistochemistry; mouse; fig s6
La Manno G, Gyllborg D, Codeluppi S, Nishimura K, Salto C, Zeisel A, et al. Molecular Diversity of Midbrain Development in Mouse, Human, and Stem Cells. Cell. 2016;167:566-580.e19 pubmed publisher
product information
cat no :
HPA012157
brand :
SIGMA
name :
Anti-AJAP1 antibody produced in rabbit
prod type :
Chemical
name suffix :
Prestige Antibodies(R) Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
storage :
-20C
storage temp :
-20C
physical form :
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
legal information :
Prestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
shipped in :
wet ice
syns :
Anti-Adherens junction-associated protein 1; Anti-Membrane protein shrew-1
wgk :
1
form :
buffered aqueous glycerol solution
antibody form :
affinity isolated antibody
application(s) :
immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; protein array: suitable
species reactivity :
human
immunogen :
Adherens junction-associated protein 1 recombinant protein epitope signature tag (PrEST)
immunogen sequence :
SGNTRRNSHQRKTNQQEESCQNLTDFPSARVPSSLDIFT
AYNETLQCSHECVRASVPVYTDETLHSTTGEYKSTFNGN
RPSSSDRHLIPVAFVSEKWFEISC
grade :
Prestige Antibodies(R) Powered by Atlas Antibodies
features and benefits :
Antibody BioguaranteeEvaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.
company information
MilliporeSigma
PO Box 14508
St. Louis, MO 63178
https://www.sigmaaldrich.com
1-800-325-3010
headquarters: USA