Anti-FXYD5 antibody produced in rabbit | MilliporeSigma HPA010817 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

MilliporeSigma

other brands :

FLUKA, Sigma-Aldrich, Roche Applied Science

product type :

antibody

product name :

Anti-FXYD5 antibody produced in rabbit

catalog :

HPA010817

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human

application :

western blot, immunohistochemistry

citations: 2

Published Application/Species/Sample/Dilution	Reference
western blot; human; 1:1000; fig 3	Tokhtaeva E, Sun H, Deiss Yehiely N, Wen Y, Soni P, Gabrielli N, et al. The O-glycosylated ectodomain of FXYD5 impairs adhesion by disrupting cell-cell trans-dimerization of Na,K-ATPase β1 subunits. J Cell Sci. 2016;129:2394-406 pubmed publisher
	Brazee P, Soni P, Tokhtaeva E, Magnani N, Yemelyanov A, PERLMAN H, et al. FXYD5 Is an Essential Mediator of the Inflammatory Response during Lung Injury. Front Immunol. 2017;8:623 pubmed publisher

product information

cat no :

HPA010817

brand :

SIGMA

name :

Anti-FXYD5 antibody produced in rabbit

prod type :

Chemical

name suffix :

Prestige Antibodies(R) Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

storage :

-20C

storage temp :

-20C

physical form :

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

legal information :

Prestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC

shipped in :

wet ice

syns :

Anti-Dysadherin; Anti-FXYD domain-containing ion transport regulator 5 precursor

wgk :

form :

buffered aqueous glycerol solution

antibody form :

affinity isolated antibody

application(s) :

protein array: suitable; western blot: suitable; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable

species reactivity :

human

immunogen :

FXYD domain-containing ion transport regulator 5 precursor recombinant protein epitope signature tag (PrEST)

immunogen sequence :

DTTSSSSADSTIMDIQVPTRAPDAVYTELQPTSPTPTWP
ADETPQPQTQTQQLEGTDGPLVTDPETHKSTKAAHPTDD
TTTLSERPSPSTDVQTDPQTLKPSGFHEDDPFFYDEHTL
R

grade :

Prestige Antibodies(R) Powered by Atlas Antibodies

features and benefits :

Antibody BioguaranteeEvaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.